{ "uniprot_canonical_ac": "P56387-1", "uniprot_ac": "P56387", "uniprot_id": "DYLT3_MOUSE", "mass": { "chemical_mass": 12958.0, "monoisotopic_mass": 12958.0 }, "refseq": { "ac": "NP_080251", "name": "dynein light chain Tctex-type 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251" }, "gene_names": [ { "name": "Dynlt3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P56387", "id": "P56387" }, { "name": "2310075M16Rik; Tcte1l", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251", "id": "NP_080251" }, { "name": "Dynlt3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251", "id": "NP_080251" }, { "name": "Tcte1l", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P56387", "id": "P56387" } ], "protein_names": [ { "name": "Dynein light chain Tctex-type 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P56387" }, { "name": "Protein 91/23", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P56387" }, { "name": "T-complex-associated testis-expressed 1-like", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P56387" }, { "name": "dynein light chain Tctex-type 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251", "id": "NP_080251" }, { "name": "protein 91/23", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251", "id": "NP_080251" } ], "function": [ { "annotation": "A role for Dynlt3 in melanosome movement, distribution, acidity and transfer. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_080251", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251" }, { "database": "PubMed", "id": "33772156", "url": "https://glygen.org/publication/PubMed/33772156" } ] }, { "annotation": "Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Probably binds BUB3 as part of transport cargo. Required for the efficient progression through mitosis.", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387#function" } ] }, { "annotation": "Data suggest that DNYLT3 is required for chromosome alignment and homologous segregation during mouse oocyte meiosis.", "evidence": [ { "database": "RefSeq", "id": "NP_080251", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251" }, { "database": "PubMed", "id": "21693773", "url": "https://glygen.org/publication/PubMed/21693773" } ] }, { "annotation": "Subpopulation of dynein, containing the DYNLT3 light chain, may be important for chromosome congression, in addition to having a role in the transport of checkpoint proteins from the kinetochore to the spindle pole", "evidence": [ { "database": "RefSeq", "id": "NP_080251", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251" }, { "database": "PubMed", "id": "17289665", "url": "https://glygen.org/publication/PubMed/17289665" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Dynlt3", "url": "https://www.uniprot.org/uniprot/P56387", "locus": { "chromosome": "X", "start_pos": 9520506, "end_pos": 9529242, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000031176", "url": "https://www.ensembl.org/id/ENSMUSG00000031176" } ] } } ], "crossref": [ { "id": "ENSMUSG00000031176", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000031176", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "67117", "url": "https://www.ncbi.nlm.nih.gov/gene/67117", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P56387", "url": "https://www.ebi.ac.uk/intact/interactors/id:P56387*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005334", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005334", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038586", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038586", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:67117", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67117", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1914367", "url": "http://www.informatics.jax.org/marker/MGI:1914367", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CLIMQKT", "url": "https://omabrowser.org/oma/group/CLIMQKT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3679412at2759", "url": "http://www.orthodb.org/?query=3679412at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21255", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21255", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21255:SF20", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21255:SF20", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03645", "url": "http://pfam.xfam.org/family/PF03645", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P56387", "url": "http://purl.obolibrary.org/obo/PR_P56387", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_080251", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P56387-1", "url": "https://www.uniprot.org/uniprot/P56387-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEGYQRPCDEVGFNADEAHNIVKECVDGVLGGNDYNENNINQWTASIVEQSITHLVKLGKAYKYIVTCAVVQRSPYGFHTASSCFWDTTSDGTCTIRWENRTMNCIVNVFAVAIVL", "length": 116, "header": "sp|P56387-1|DYLT3_MOUSE Isoform 1 of Dynein light chain Tctex-type 3 OS=Mus musculus OX=10090 GN=Dynlt3 PE=1 SV=1 CANONICAL=P56387-1" }, "isoforms": [ { "isoform_ac": "P56387-1", "url": "", "sequence": { "sequence": "MEGYQRPCDEVGFNADEAHNIVKECVDGVLGGNDYNENNINQWTASIVEQSITHLVKLGKAYKYIVTCAVVQRSPYGFHTASSCFWDTTSDGTCTIRWENRTMNCIVNVFAVAIVL", "length": 116, "header": "sp|P56387-1|DYLT3_MOUSE Isoform 1 of Dynein light chain Tctex-type 3 OS=Mus musculus OX=10090 GN=Dynlt3 PE=1 SV=1 CANONICAL=P56387-1" }, "locus": { "chromosome": "X", "start_pos": 9529137, "end_pos": 9522229, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000033519", "url": "https://www.ensembl.org/id/ENSMUST00000033519" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000033519", "url": "https://www.ensembl.org/id/ENSMUSP00000033519" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Endogenously nitrated proteins in mouse brain: links to neurodegenerative disease.", "journal": "Biochemistry", "date": "2006", "authors": "Sacksteder CA, Qian WJ, Knyushko TV, Wang H, Chin MH, Lacan G, Melega WP, Camp DG 2nd, Smith RD, Smith DJ, Squier TC, Bigelow DJ", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "reference": [ { "type": "PubMed", "id": "16800626", "url": "https://glygen.org/publication/PubMed/16800626" } ] }, { "title": "The DYNLT3 light chain directly links cytoplasmic dynein to a spindle checkpoint protein, Bub3.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Lo KW, Kogoy JM, Pfister KK", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" }, { "database": "RefSeq", "id": "NP_080251", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251" } ], "reference": [ { "type": "PubMed", "id": "17289665", "url": "https://glygen.org/publication/PubMed/17289665" } ] }, { "title": "DYNLT3 is required for chromosome alignment during mouse oocyte meiotic maturation.", "journal": "Reproductive sciences (Thousand Oaks, Calif.)", "date": "2011", "authors": "Huang X, Wang HL, Qi ST, Wang ZB, Tong JS, Zhang QH, Ouyang YC, Hou Y, Schatten H, Qi ZQ, Sun QY", "evidence": [ { "database": "RefSeq", "id": "NP_080251", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251" } ], "reference": [ { "type": "PubMed", "id": "21693773", "url": "https://glygen.org/publication/PubMed/21693773" } ] }, { "title": "A role for Dynlt3 in melanosome movement, distribution, acidity and transfer.", "journal": "Communications biology", "date": "2021", "authors": "Aktary Z, Conde-Perez A, Rambow F, Di Marco M, Amblard F, Hurbain I, Raposo G, Delevoye C, Coscoy S, Larue L", "evidence": [ { "database": "RefSeq", "id": "NP_080251", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080251" } ], "reference": [ { "type": "PubMed", "id": "33772156", "url": "https://glygen.org/publication/PubMed/33772156" } ] } ], "pathway": [ { "id": "mmu:67117", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67117", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P51808-1", "protein_name": "Dynein light chain Tctex-type 3", "gene_name": "DYNLT3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL", "length": 116 }, "evidence": [ { "id": "45226552", "url": "http://www.informatics.jax.org/homology/45226552", "database": "MGI" }, { "id": "P56387", "url": "https://omabrowser.org/oma/group/P56387/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" }, { "name": "kinetochore", "id": "GO:0000776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000776", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" }, { "name": "cytoplasmic dynein complex", "id": "GO:0005868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005868", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" }, { "name": "mitotic spindle astral microtubule", "id": "GO:0061673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061673", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" }, { "name": "dynein intermediate chain binding", "id": "GO:0045505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045505", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "positive regulation of mitotic cell cycle", "id": "GO:0045931", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045931", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" }, { "name": "regulation of mitotic cell cycle", "id": "GO:0007346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007346", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" }, { "name": "cell cycle", "id": "GO:0007049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" }, { "name": "microtubule-based movement", "id": "GO:0007018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007018", "evidence": [ { "database": "UniProtKB", "id": "P56387", "url": "https://www.uniprot.org/uniprot/P56387" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 100, "end_pos": 102, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }