{ "uniprot_canonical_ac": "P55065-1", "uniprot_ac": "P55065", "uniprot_id": "PLTP_MOUSE", "mass": { "chemical_mass": 54453.0, "monoisotopic_mass": 54453.0 }, "refseq": { "ac": "NP_035255", "name": "phospholipid transfer protein isoform a precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" }, "gene_names": [ { "name": "Pltp", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P55065", "id": "P55065" }, { "name": "Bpife; OD107", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255", "id": "NP_035255" }, { "name": "Pltp", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255", "id": "NP_035255" } ], "protein_names": [ { "name": "Phospholipid transfer protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P55065" }, { "name": "Lipid transfer protein II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P55065" }, { "name": "lipid transfer protein II", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255", "id": "NP_035255" }, { "name": "phospholipid transfer protein isoform a precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255", "id": "NP_035255" } ], "function": [ { "annotation": "C3H/HeNSlc mouse with low phospholipid transfer protein expression showed dyslipidemia. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" }, { "database": "PubMed", "id": "37620514", "url": "https://glygen.org/publication/PubMed/37620514" } ] }, { "annotation": "Elevated cholesteryl ester transfer and phospholipid transfer proteins aggravated psoriasis in imiquimod-induced mouse models. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" }, { "database": "PubMed", "id": "35982498", "url": "https://glygen.org/publication/PubMed/35982498" } ] }, { "annotation": "Increased Weight Gain and Insulin Resistance in HF-Fed PLTP Deficient Mice Is Related to Altered Inflammatory Response and Plasma Transport of Gut-Derived LPS. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" }, { "database": "PubMed", "id": "36362012", "url": "https://glygen.org/publication/PubMed/36362012" } ] }, { "annotation": "Inducible phospholipid transfer protein deficiency ameliorates atherosclerosis.", "evidence": [ { "database": "RefSeq", "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" }, { "database": "PubMed", "id": "33798923", "url": "https://glygen.org/publication/PubMed/33798923" } ] }, { "annotation": "Intra-Abdominal Lipopolysaccharide Clearance and Inactivation in Peritonitis: Key Roles for Lipoproteins and the Phospholipid Transfer Protein. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" }, { "database": "PubMed", "id": "34054798", "url": "https://glygen.org/publication/PubMed/34054798" } ] }, { "annotation": "Mediates the transfer of phospholipids and free cholesterol from triglyceride-rich lipoproteins (low density lipoproteins or LDL and very low density lipoproteins or VLDL) into high-density lipoproteins (HDL) as well as the exchange of phospholipids between triglyceride-rich lipoproteins themselves (PubMed:7654777, PubMed:7615508, PubMed:10079112). Facilitates the transfer of a spectrum of different lipid molecules, including sphingomyelin, phosphatidylcholine, phosphatidylinositol, phosphatidylglycerol, and phosphatidyl ethanolamine (PubMed:10079112). Plays an important role in HDL remodeling which involves modulating the size and composition of HDL (By similarity). Also plays a key role in the uptake of cholesterol from peripheral cells and tissues that is subsequently transported to the liver for degradation and excretion (By similarity). Two distinct forms of PLTP exist in plasma: an active form that can transfer phosphatidylcholine from phospholipid vesicles to HDL, and an inactive form that lacks this capability (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065#function" }, { "database": "PubMed", "id": "10079112", "url": "https://glygen.org/publication/PubMed/10079112" }, { "database": "PubMed", "id": "7615508", "url": "https://glygen.org/publication/PubMed/7615508" }, { "database": "PubMed", "id": "7654777", "url": "https://glygen.org/publication/PubMed/7654777" }, { "database": "UniProtKB", "id": "P55058", "url": "https://www.uniprot.org/uniprot/P55058#function" } ] } ], "disease": [ { "disease_id": "DOID:10140", "recommended_name": { "id": "DOID:10140", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10140", "name": "dry eye syndrome", "description": "A lacrimal apparatus disease that is characterized by persistent irritation or burning of the coreneal surface." }, "synonyms": [ { "id": "DOID:10140", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10140", "name": "Tear film insufficiency", "description": "" }, { "id": "DOID:10140", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10140", "name": "dry eye disease", "description": "" } ], "evidence": [ { "id": "10140", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10140" } ] }, { "disease_id": "DOID:1936", "recommended_name": { "id": "DOID:1936", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1936", "name": "atherosclerosis", "description": "" }, "synonyms": [], "evidence": [ { "id": "1936", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1936" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Pltp", "url": "https://www.uniprot.org/uniprot/P55065", "locus": { "chromosome": "2", "start_pos": 164681438, "end_pos": 164699631, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000017754", "url": "https://www.ensembl.org/id/ENSMUSG00000017754" } ] } } ], "crossref": [ { "id": "ENSMUSG00000017754", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000017754", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00025", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00025", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00026", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00026", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "18830", "url": "https://www.ncbi.nlm.nih.gov/gene/18830", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0001607", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0001607", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0001608", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0001608", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0001609", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0001609", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0003695", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0003695", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR001124", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001124", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017942", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017942", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017943", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017943", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017954", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017954", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030675", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030675", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032942", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032942", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:18830", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18830", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "103151", "url": "http://www.informatics.jax.org/marker/MGI:103151", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P55065", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P55065", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "GMFAYYS", "url": "https://omabrowser.org/oma/group/GMFAYYS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5307035at2759", "url": "http://www.orthodb.org/?query=5307035at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10504", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10504", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10504:SF16", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10504:SF16", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01273", "url": "http://pfam.xfam.org/family/PF01273", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02886", "url": "http://pfam.xfam.org/family/PF02886", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P55065", "url": "http://purl.obolibrary.org/obo/PR_P55065", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8964058", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "36435", "url": "https://www.rhea-db.org/rhea/36435", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38571", "url": "https://www.rhea-db.org/rhea/38571", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38691", "url": "https://www.rhea-db.org/rhea/38691", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38895", "url": "https://www.rhea-db.org/rhea/38895", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "39723", "url": "https://www.rhea-db.org/rhea/39723", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "39727", "url": "https://www.rhea-db.org/rhea/39727", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "39743", "url": "https://www.rhea-db.org/rhea/39743", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46488", "url": "https://www.rhea-db.org/rhea/46488", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46492", "url": "https://www.rhea-db.org/rhea/46492", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46496", "url": "https://www.rhea-db.org/rhea/46496", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A2A5K2", "url": "https://www.uniprot.org/uniprot/A2A5K2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A5K2-1", "url": "https://www.uniprot.org/uniprot/A2A5K2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A5K3", "url": "https://www.uniprot.org/uniprot/A2A5K3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A5K3-1", "url": "https://www.uniprot.org/uniprot/A2A5K3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A5K4", "url": "https://www.uniprot.org/uniprot/A2A5K4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A5K4-1", "url": "https://www.uniprot.org/uniprot/A2A5K4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P55065-1", "url": "https://www.uniprot.org/uniprot/P55065-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVLLWALFLALLAGAHAELPGCKIRVTSAALDLVKQEGLRFLEQELETITIPDVYGAKGHFYYNISDVRVTQLHLISSELHFQPDQDLLLNISNASLGLHFRRQLLYWFLYDGGYINASAEGVSIRTGLQLSQDSSGRIKVSNVSCEASVSKMNMAFGGTFRRMYNFFSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDDLVGIDYSLLKDPVVSNGNLDMEFRGAFFPLKEDNWSLPNRAVEPQLEDDERMVYVAFSEFFFDSAMESYFQAGALQLTLVGDKVPSDLDMLLRATYFGSIVLLSPTVINSPLKLKLEATSPPRCTIKPSGTTISITASVTITLAPPMLPEVELSKMIMEGRLSAKLTLRGKALRVKLDLRRFQIYSNQSALESLALIPLQAPLKTLLQIGVMPLLNERTWRGVQIPLPEGINFVREVVTNHAGFVTVGADLHFAKGLREVIDKNRPADVAASHVPPPSAAAA", "length": 493, "header": "sp|P55065-1|PLTP_MOUSE Isoform 1 of Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1 CANONICAL=P55065-1" }, "isoforms": [ { "isoform_ac": "A2A5K2-1", "url": "", "sequence": { "sequence": "MVLLWALFLALLAGAHAELPGCKIRVTSAALDLVKQEGLRFLEQELETITIPDVYGAKGHFYYNISDVRVTQLHLISSELHFQPDQDLLLNISNASLGLHFRRQLLYWFLRMYNFFSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDDLVGIDYSLLKDPVVSNGNLDMEFRGAFFPLKEDNWSLPNRAVEPQLEDDERMVYVAFSEFFFDSAMESYFQAGALQLTLVGDKVPSDLDMLLRATYFGSIVLLSPTVINSPLKLKLEATSPPRCTIKPSGTTISITASVTITLAPPMLPEVELSKMIMEGRLSAKLTLRGKALRVKLDLRRFQIYSNQSALESLALIPLQAPLKTLLQIGVMPLLNERTWRGVQIPLPEGINFVREVVTNHAGFVTVGADLHFAKGLREVIDKNRPADVAASHVPPPSAAAA", "length": 441, "header": "tr|A2A5K2-1|PLTP_MOUSE Computationally mapped isoform of Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1 CANONICAL=P55065-1" }, "locus": { "chromosome": "2", "start_pos": 164698906, "end_pos": 164681629, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000109317.10", "url": "https://www.ensembl.org/id/ENSMUST00000109317.10" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000104940.4", "url": "https://www.ensembl.org/id/ENSMUSP00000104940.4" } ] } }, { "isoform_ac": "A2A5K3-1", "url": "", "sequence": { "sequence": "MVLLWALFLALLAGAHAELPGCKIRVTSAALDLVKQEGLRFLEQELETITIPDVYGAKGHFYYNISDVRVTQLHLISSELHFQPDQDLLLNISNASLGLHFRRQLLYWFLYDGGYINASAEGVSIRTGLQLSQDSSGRIKVSNVSCE", "length": 147, "header": "tr|A2A5K3-1|A2A5K3_MOUSE Computationally mapped isoform of Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1 CANONICAL=P55065-1" }, "locus": { "chromosome": "2", "start_pos": 164698906, "end_pos": 164696230, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000128110.2", "url": "https://www.ensembl.org/id/ENSMUST00000128110.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000122760.2", "url": "https://www.ensembl.org/id/ENSMUSP00000122760.2" } ] } }, { "isoform_ac": "A2A5K4-1", "url": "", "sequence": { "sequence": "MVLLWALFLALLAVKQEGLRFLEQELETITIPDVYGAKGHFYYNISDVRVTQLHLISSELHFQPDQDLLLNISNASLGLHFRRQLLYWFLYDGGYINASAEGVSIRTGLQLSQDSSGRIKVSNVSCEASVSKMNMAFGGTFRRMYNFFSTFITSGMRFLLNQQVW", "length": 165, "header": "tr|A2A5K4-1|PLTP_MOUSE Computationally mapped isoform of Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1 CANONICAL=P55065-1" }, "locus": { "chromosome": "2", "start_pos": 164698906, "end_pos": 164694531, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000156255.8", "url": "https://www.ensembl.org/id/ENSMUST00000156255.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000119955.2", "url": "https://www.ensembl.org/id/ENSMUSP00000119955.2" } ] } }, { "isoform_ac": "P55065-1", "url": "", "sequence": { "sequence": "MVLLWALFLALLAGAHAELPGCKIRVTSAALDLVKQEGLRFLEQELETITIPDVYGAKGHFYYNISDVRVTQLHLISSELHFQPDQDLLLNISNASLGLHFRRQLLYWFLYDGGYINASAEGVSIRTGLQLSQDSSGRIKVSNVSCEASVSKMNMAFGGTFRRMYNFFSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDDLVGIDYSLLKDPVVSNGNLDMEFRGAFFPLKEDNWSLPNRAVEPQLEDDERMVYVAFSEFFFDSAMESYFQAGALQLTLVGDKVPSDLDMLLRATYFGSIVLLSPTVINSPLKLKLEATSPPRCTIKPSGTTISITASVTITLAPPMLPEVELSKMIMEGRLSAKLTLRGKALRVKLDLRRFQIYSNQSALESLALIPLQAPLKTLLQIGVMPLLNERTWRGVQIPLPEGINFVREVVTNHAGFVTVGADLHFAKGLREVIDKNRPADVAASHVPPPSAAAA", "length": 493, "header": "sp|P55065-1|PLTP_MOUSE Isoform 1 of Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1 CANONICAL=P55065-1" }, "locus": { "chromosome": "2", "start_pos": 164698906, "end_pos": 164681629, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000109316", "url": "https://www.ensembl.org/id/ENSMUST00000109316" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000104939", "url": "https://www.ensembl.org/id/ENSMUSP00000104939" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 117, "start_aa": "Asn", "end_pos": 117, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn117", "evidence": [ { "id": "P55065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55065#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 143, "start_aa": "Asn", "end_pos": 143, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn143", "evidence": [ { "id": "P55065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55065#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 245, "start_aa": "Asn", "end_pos": 245, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn245", "evidence": [ { "id": "P55065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55065#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 247, "start_aa": "Ser", "end_pos": 247, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser247", "evidence": [ { "id": "P55065", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P55065" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 398, "start_aa": "Asn", "end_pos": 398, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn398", "evidence": [ { "id": "P55065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55065#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P55065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55065#ptm_processing" }, { "id": "16944957", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16944957" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 91, "start_aa": "Asn", "end_pos": 91, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn91", "evidence": [ { "id": "P55065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55065#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 94, "start_aa": "Asn", "end_pos": 94, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn94", "evidence": [ { "id": "P55065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55065#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Targeted mutation of plasma phospholipid transfer protein gene markedly reduces high-density lipoprotein levels.", "journal": "J. Clin. Invest.", "date": "1999", "authors": "Lin M., Ji Y., Tall A.R., Bruce C., Jiang X.C., Francone O.L., Mar J.", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "reference": [ { "type": "PubMed", "id": "10079112", "url": "https://glygen.org/publication/PubMed/10079112" } ] }, { "title": "Proteome-wide characterization of N-glycosylation events by diagonal chromatography.", "journal": "Journal of proteome research", "date": "2006", "authors": "Ghesquiere B, Van Damme J, Martens L, Vandekerckhove J, Gevaert K", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065#ptm_processing" }, { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "reference": [ { "type": "PubMed", "id": "16944957", "url": "https://glygen.org/publication/PubMed/16944957" } ] }, { "title": "Inducible phospholipid transfer protein deficiency ameliorates atherosclerosis.", "journal": "Atherosclerosis", "date": "2021", "authors": "Zhang K, Zheng J, Chen Y, Dong J, Li Z, Chiang YP, He M, Huang Q, Tang H, Jiang XC", "evidence": [ { "database": "RefSeq", "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" } ], "reference": [ { "type": "PubMed", "id": "33798923", "url": "https://glygen.org/publication/PubMed/33798923" } ] }, { "title": "Intra-Abdominal Lipopolysaccharide Clearance and Inactivation in Peritonitis: Key Roles for Lipoproteins and the Phospholipid Transfer Protein.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Nguyen M, Pallot G, Jalil A, Tavernier A, Dusuel A, Le Guern N, Lagrost L, Pais de Barros JP, Choubley H, Bergas V, Guinot PG, Masson D, Bouhemad B, Gautier T", "evidence": [ { "database": "RefSeq", "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" } ], "reference": [ { "type": "PubMed", "id": "34054798", "url": "https://glygen.org/publication/PubMed/34054798" } ] }, { "title": "Elevated cholesteryl ester transfer and phospholipid transfer proteins aggravated psoriasis in imiquimod-induced mouse models.", "journal": "Lipids in health and disease", "date": "2022", "authors": "Chen J, Qi H, Liu L, Niu Y, Yu S, Qin S, He L", "evidence": [ { "database": "RefSeq", "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" } ], "reference": [ { "type": "PubMed", "id": "35982498", "url": "https://glygen.org/publication/PubMed/35982498" } ] }, { "title": "Increased Weight Gain and Insulin Resistance in HF-Fed PLTP Deficient Mice Is Related to Altered Inflammatory Response and Plasma Transport of Gut-Derived LPS.", "journal": "International journal of molecular sciences", "date": "2022-10-30", "authors": "Lebrun Lor\u00e8ne J, Pallot Ga\u00ebtan, Nguyen Maxime, Tavernier Annabelle, Dusuel Alois, Pilot Thomas, Deckert Val\u00e9rie, Dugail Isabelle, Le Guern Naig, Pais De Barros Jean-Paul, Benkhaled Anissa, Choubley H\u00e9l\u00e8ne, Lagrost Laurent, Masson David, Gautier Thomas, Grober Jacques", "evidence": [ { "database": "RefSeq", "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" } ], "reference": [ { "type": "PubMed", "id": "36362012", "url": "https://glygen.org/publication/PubMed/36362012" } ] }, { "title": "Chemoproteomic and Transcriptomic Analysis Reveals that O-GlcNAc Regulates Mouse Embryonic Stem Cell Fate through the Pluripotency Network.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2023-02-27", "authors": "Hao Yi, Li Xiang, Qin Ke, Shi Yujie, He Yanwen, Zhang Che, Cheng Bo, Zhang Xiwen, Hu Guangyu, Liang Shuyu, Tang Qi, Chen Xing", "evidence": [ { "database": "O-GlcNAc Database", "id": "P55065", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P55065" } ], "reference": [ { "type": "PubMed", "id": "36852467", "url": "https://glygen.org/publication/PubMed/36852467" } ] }, { "title": "C3H/HeNSlc mouse with low phospholipid transfer protein expression showed dyslipidemia.", "journal": "Scientific reports", "date": "2023-08-24", "authors": "Kobayashi Misato, Kanbe Fumi, Ishii Reika, Tsubouchi Hiroki, Hirai Kana, Miyasaka Yuki, Ohno Tamio, Oda Hiroaki, Ikeda Saiko, Katoh Hirokazu, Ichiyanagi Kenji, Ishikawa Akira, Murai Atsushi, Horio Fumihiko", "evidence": [ { "database": "RefSeq", "id": "NP_035255", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035255" } ], "reference": [ { "type": "PubMed", "id": "37620514", "url": "https://glygen.org/publication/PubMed/37620514" } ] }, { "title": "Regulation of murine plasma phospholipid transfer protein activity and mRNA levels by lipopolysaccharide and high cholesterol diet.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Jiang XC, Bruce C", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "reference": [ { "type": "PubMed", "id": "7615508", "url": "https://glygen.org/publication/PubMed/7615508" } ] }, { "title": "Functional expression of human and mouse plasma phospholipid transfer protein: effect of recombinant and plasma PLTP on HDL subspecies.", "journal": "Biochim. Biophys. Acta", "date": "1995", "authors": "Albers JJ, Wolfbauer G, Cheung MC, Day JR, Ching AF, Lok S, Tu AY", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "reference": [ { "type": "PubMed", "id": "7654777", "url": "https://glygen.org/publication/PubMed/7654777" } ] } ], "pathway": [ { "id": "mmu:18830", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18830", "resource": "KEGG Pathway" }, { "id": "R-MMU-8964058", "name": "HDL remodeling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8964058", "resource": "Reactome", "description": "HDL remodeling" } ], "orthologs": [ { "uniprot_canonical_ac": "E9PSP1-1", "protein_name": "Phospholipid transfer protein", "gene_name": "Pltp", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MALLPALFLALLAGAHAELPGCKIRVTSAALELVKQEGLRFLEQELEDINIPDVYGAKGHFYYNISDVKVTQLQLISSELHFQPDQDLLLNISNASLGLHFRRQLLYWFFYDGGYINASAEGVSIRTGLQLSRDPTGRIKVSNVSCEASVSKINMAFGGTFRRMYNFFSTFITSGMRFLLNQQICPVLHHAGTVLLNSLLDTVPVRSSVDELVGIDYSLLKDPVVSNGNLDMEFRGAFFPLKEGNWSLLNKAVEPQLDDDERMVYVAFSEFFFDSAMESYFQAGALQLTLVGDKVPNDLDMLLRATYFGSIVLQSPTVINSPLKLKLQAISSPRCTIKPSGTTISVTASVTISLAPPTMPEVELSKMIMEGRLSAKLTLKGKALRAKLDLRRFQIYSNQSALESLALIPLQAPLKTLLQIGVMPLLNERIWRGVQIPLPEGINFVHEVVTNHAGFVTVGADLHFAKGLREVIDKNRSAGGADTVDSSVPPPSAAAA", "length": 496 }, "evidence": [ { "id": "45237808", "url": "http://www.informatics.jax.org/homology/45237808", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P55058-1", "protein_name": "Phospholipid transfer protein", "gene_name": "PLTP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALFGALFLALLAGAHAEFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVIDSPLKLELRVLAPPRCTIKPSGTTISVTASVTIALVPPDQPEVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQIGVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVIEKNRPADVRASTAPTPSTAAV", "length": 493 }, "evidence": [ { "id": "45237808", "url": "http://www.informatics.jax.org/homology/45237808", "database": "MGI" }, { "id": "P55065", "url": "https://omabrowser.org/oma/group/P55065/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 22, "go_terms": [ { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phosphatidic acid transfer activity", "id": "GO:1990050", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990050", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "high-density lipoprotein particle binding", "id": "GO:0008035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008035", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phosphatidylethanolamine binding", "id": "GO:0008429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008429", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phosphatidylcholine binding", "id": "GO:0031210", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031210", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phosphatidylglycerol binding", "id": "GO:1901611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901611", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phosphatidic acid binding", "id": "GO:0070300", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070300", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "ceramide binding", "id": "GO:0097001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097001", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "ceramide transfer activity", "id": "GO:0120017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120017", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "low-density lipoprotein particle binding", "id": "GO:0030169", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030169", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phosphatidylethanolamine transfer activity", "id": "GO:1904121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904121", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "diacylglycerol binding", "id": "GO:0019992", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019992", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phosphatidylinositol transfer activity", "id": "GO:0008526", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008526", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phosphatidylcholine transporter activity", "id": "GO:0008525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008525", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "very-low-density lipoprotein particle binding", "id": "GO:0034189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034189", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "cholesterol transfer activity", "id": "GO:0120020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120020", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phosphatidylcholine transfer activity", "id": "GO:0120019", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120019", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "diacylglyceride transfer activity", "id": "GO:0140337", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140337", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "sphingomyelin transfer activity", "id": "GO:0140338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140338", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phosphatidylglycerol transfer activity", "id": "GO:0140339", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140339", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "cerebroside transfer activity", "id": "GO:0140340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140340", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phospholipid transfer activity", "id": "GO:0120014", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120014", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "high-density lipoprotein particle", "id": "GO:0034364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034364", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "glycolipid transport", "id": "GO:0046836", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046836", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "lipid transport", "id": "GO:0006869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "positive regulation of cholesterol efflux", "id": "GO:0010875", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010875", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "ceramide transport", "id": "GO:0035627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035627", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "flagellated sperm motility", "id": "GO:0030317", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030317", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "phospholipid transport", "id": "GO:0015914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015914", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "high-density lipoprotein particle remodeling", "id": "GO:0034375", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034375", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" }, { "name": "vitamin E biosynthetic process", "id": "GO:0010189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010189", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 117, "end_pos": 119, "annotation": "n_glycosylation_sequon" }, { "start_pos": 143, "end_pos": 145, "annotation": "n_glycosylation_sequon" }, { "start_pos": 245, "end_pos": 247, "annotation": "n_glycosylation_sequon" }, { "start_pos": 398, "end_pos": 400, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" }, { "start_pos": 91, "end_pos": 93, "annotation": "n_glycosylation_sequon" }, { "start_pos": 94, "end_pos": 96, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Glycosylation is necessary for secretion and its phospholipid transfer activity.", "evidence": [ { "database": "UniProtKB", "id": "P55065", "url": "https://www.uniprot.org/uniprot/P55065" }, { "database": "PubMed", "id": "P55058", "url": "https://glygen.org/publication/PubMed/P55058" } ] } ], "interactions": [], "reactions": [ { "id": "36435", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphate(in) = a 1,2-diacyl-sn-glycero-3-phosphate(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "36435", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36435" } ] }, { "id": "38571", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P58195-1", "O15162-1", "Q9JJ00-1" ], "evidence": [ { "id": "38571", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38571" } ] }, { "id": "38691", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol)(in) = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "38691", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38691" } ] }, { "id": "38895", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphoethanolamine(in) = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P58195-1", "O15162-1", "Q9JJ00-1" ], "evidence": [ { "id": "38895", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38895" } ] }, { "id": "39723", "name": "", "equation": "a 1,2-diacyl-sn-glycerol(in) = a 1,2-diacyl-sn-glycerol(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "39723", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/39723" } ] }, { "id": "39727", "name": "", "equation": "a sphingomyelin(in) = a sphingomyelin(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "39727", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/39727" } ] }, { "id": "39743", "name": "", "equation": "1,2-diacyl-sn-glycero-3-phospho-(1'-sn-glycerol)(in) = 1,2-diacyl-sn-glycero-3-phospho-(1'-sn-glycerol)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "39743", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/39743" } ] }, { "id": "46488", "name": "", "equation": "1,2-dihexadecanoyl-sn-glycero-3-phosphocholine(in) = 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "46488", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46488" } ] }, { "id": "46492", "name": "", "equation": "1-hexadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphoethanolamine(in) = 1-hexadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphoethanolamine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "46492", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46492" } ] }, { "id": "46496", "name": "", "equation": "N-(hexadecanoyl)-sphing-4-enine-1-phosphocholine(in) = N-(hexadecanoyl)-sphing-4-enine-1-phosphocholine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "46496", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46496" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O15162", "gene_name": "PLSCR1", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "O15162", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15162" } ] } ] }, { "uniprot_ac": "P58195", "gene_name": "Plscr1", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "P58195", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58195" } ] } ] }, { "uniprot_ac": "Q9JJ00", "gene_name": "Plscr1", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q9JJ00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ00" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 7 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }