{ "uniprot_canonical_ac": "P54727-1", "uniprot_ac": "P54727", "uniprot_id": "RD23B_HUMAN", "mass": { "chemical_mass": 43171.0, "monoisotopic_mass": 43171.0 }, "refseq": { "ac": "NP_001231653", "name": "UV excision repair protein RAD23 homolog B isoform 3", "summary": "The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Sep 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653" }, "gene_names": [ { "name": "RAD23B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P54727", "id": "P54727" }, { "name": "HHR23B; HR23B; P58", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653", "id": "NP_001231653" }, { "name": "RAD23B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653", "id": "NP_001231653" } ], "protein_names": [ { "name": "UV excision repair protein RAD23 homolog B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P54727" }, { "name": "HR23B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P54727" }, { "name": "UV excision repair protein RAD23 homolog B isoform 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653", "id": "NP_001231653" }, { "name": "XP-C repair complementing protein; XP-C repair complementing complex 58 kDa; RAD23, yeast homolog of, B; UV excision repair protein RAD23 homolog B; XP-C repair-complementing complex 58 kDa protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653", "id": "NP_001231653" }, { "name": "XP-C repair-complementing complex 58 kDa protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P54727" }, { "name": "hHR23B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P54727" }, { "name": "p58", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P54727" } ], "function": [ { "annotation": "Cytoplasmic RAD23B interacts with CORO1C to synergistically promote colorectal cancer progression and metastasis.", "evidence": [ { "database": "RefSeq", "id": "NP_001231653", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653" }, { "database": "PubMed", "id": "34062216", "url": "https://glygen.org/publication/PubMed/34062216" } ] }, { "annotation": "Deubiquitinase PSMD7 promotes the proliferation, invasion, and cisplatin resistance of gastric cancer cells by stabilizing RAD23B. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001231653", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653" }, { "database": "PubMed", "id": "34512150", "url": "https://glygen.org/publication/PubMed/34512150" } ] }, { "annotation": "Involved in global genome nucleotide excision repair (GG-NER) by acting as component of the XPC complex. Cooperatively with CETN2 appears to stabilize XPC. May protect XPC from proteasomal degradation.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727#function" } ] }, { "annotation": "Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome. May play a role in endoplasmic reticulum-associated degradation (ERAD) of misfolded glycoproteins by association with PNGase and delivering deglycosylated proteins to the proteasome.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727#function" } ] }, { "annotation": "The XPC complex is proposed to represent the first factor bound at the sites of DNA damage and together with other core recognition factors, XPA, RPA and the TFIIH complex, is part of the pre-incision (or initial recognition) complex. The XPC complex recognizes a wide spectrum of damaged DNA characterized by distortions of the DNA helix such as single-stranded loops, mismatched bubbles or single-stranded overhangs. The orientation of XPC complex binding appears to be crucial for inducing a productive NER. XPC complex is proposed to recognize and to interact with unpaired bases on the undamaged DNA strand which is followed by recruitment of the TFIIH complex and subsequent scanning for lesions in the opposite strand in a 5'-to-3' direction by the NER machinery. Cyclobutane pyrimidine dimers (CPDs) which are formed upon UV-induced DNA damage esacpe detection by the XPC complex due to a low degree of structural perurbation. Instead they are detected by the UV-DDB complex which in turn recruits and cooperates with the XPC complex in the respective DNA repair. In vitro, the XPC:RAD23B dimer is sufficient to initiate NER; it preferentially binds to cisplatin and UV-damaged double-stranded DNA and also binds to a variety of chemically and structurally diverse DNA adducts. XPC:RAD23B contacts DNA both 5' and 3' of a cisplatin lesion with a preference for the 5' side. XPC:RAD23B induces a bend in DNA upon binding. XPC:RAD23B stimulates the activity of DNA glycosylases TDG and SMUG1.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727#function" } ] }, { "annotation": "The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Sep 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001231653", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1181533322", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1181533322" }, { "id": "rs1181533322", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1181533322" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 95, "end_pos": 95, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (STT->NTT); o-glyco-site-loss (S->N).", "chr_id": "9", "chr_pos": "107306434", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S95", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs79639067", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs79639067" }, { "id": "rs79639067", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs79639067" }, { "id": "rs79639067", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs79639067#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 102, "end_pos": 102, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "9", "chr_pos": "107306454", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S102", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs79639067", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs79639067" }, { "id": "rs79639067", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs79639067" }, { "id": "rs79639067", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs79639067#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 102, "end_pos": 102, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "9", "chr_pos": "107306454", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S102", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1159712312", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1159712312" }, { "id": "rs1159712312", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1159712312" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 105, "end_pos": 105, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "9", "chr_pos": "107306464", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T105", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1207439891", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1207439891" }, { "id": "rs1207439891", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1207439891#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 112, "end_pos": 112, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "9", "chr_pos": "107306484", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T112", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776897206", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776897206" }, { "id": "rs776897206", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776897206" }, { "id": "rs776897206", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776897206" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 112, "end_pos": 112, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "9", "chr_pos": "107306485", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T112", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs986016973", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs986016973" }, { "id": "rs986016973", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs986016973" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 130, "end_pos": 130, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "9", "chr_pos": "107306538", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S130", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P54727", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P54727" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 141, "end_pos": 141, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->C).", "chr_id": "9", "chr_pos": "107306571", "ref_nt": "A", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S141", "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs141800980", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141800980" }, { "id": "rs141800980", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141800980#frequency_tab" }, { "id": "rs141800980", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141800980" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 141, "end_pos": 141, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "9", "chr_pos": "107306572", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S141", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs141800980", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141800980" }, { "id": "rs141800980", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141800980#frequency_tab" }, { "id": "rs141800980", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141800980" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 141, "end_pos": 141, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "9", "chr_pos": "107306572", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S141", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1386224950", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1386224950" }, { "id": "rs1386224950", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1386224950" }, { "id": "rs1386224950", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1386224950#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 165, "end_pos": 165, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DST->NST).", "chr_id": "9", "chr_pos": "107306643", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D165", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1443425269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1443425269" }, { "id": "rs1443425269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1443425269#frequency_tab" }, { "id": "21984974", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21984974" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 170, "end_pos": 170, "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "9", "chr_pos": "107311692", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D170", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1423546846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423546846" }, { "id": "rs1423546846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1423546846" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 246, "end_pos": 246, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "9", "chr_pos": "107322037", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S246", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1257943170", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257943170" }, { "id": "rs1257943170", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257943170" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 247, "end_pos": 247, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "9", "chr_pos": "107322040", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T247", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1484321441", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1484321441" }, { "id": "rs1484321441", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1484321441" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 252, "end_pos": 252, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "9", "chr_pos": "107322056", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S252", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1564251992", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564251992" }, { "id": "rs1564251992", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564251992" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 253, "end_pos": 253, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "9", "chr_pos": "107322058", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S253", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201887317", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201887317" }, { "id": "rs201887317", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201887317" }, { "id": "rs201887317", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201887317#frequency_tab" }, { "id": "rs201887317", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201887317" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 261, "end_pos": 261, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "9", "chr_pos": "107322082", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T261", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780025783", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025783" }, { "id": "rs780025783", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025783" }, { "id": "rs780025783", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780025783" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 262, "end_pos": 262, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "9", "chr_pos": "107322085", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T262", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs372514872", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372514872" }, { "id": "rs372514872", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372514872" }, { "id": "rs372514872", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372514872" }, { "id": "rs372514872", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372514872#frequency_tab" }, { "id": "rs372514872", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372514872" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 262, "end_pos": 262, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "9", "chr_pos": "107322086", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T262", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1308492422", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1308492422" }, { "id": "rs1308492422", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1308492422" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 263, "end_pos": 263, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "9", "chr_pos": "107322088", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T263", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P54727", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P54727" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 263, "end_pos": 263, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "9", "chr_pos": "107322089", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T263", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs747959796", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747959796" }, { "id": "rs747959796", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747959796" }, { "id": "rs747959796", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747959796#frequency_tab" }, { "id": "rs747959796", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747959796" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 265, "end_pos": 265, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "9", "chr_pos": "107322094", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T265", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs985132401", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs985132401" }, { "id": "rs985132401", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs985132401#frequency_tab" }, { "id": "rs985132401", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs985132401" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 265, "end_pos": 265, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "9", "chr_pos": "107322095", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T265", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs985132401", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs985132401" }, { "id": "rs985132401", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs985132401#frequency_tab" }, { "id": "rs985132401", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs985132401" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 265, "end_pos": 265, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "9", "chr_pos": "107322095", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T265", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776063038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776063038" }, { "id": "rs776063038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776063038" }, { "id": "rs776063038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776063038#frequency_tab" }, { "id": "rs776063038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776063038" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 271, "end_pos": 271, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "9", "chr_pos": "107322113", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S271", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P54727", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P54727" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 271, "end_pos": 271, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->Y).", "chr_id": "9", "chr_pos": "107322113", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S271", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs56175121", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56175121" }, { "id": "rs56175121", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs56175121" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 88, "end_pos": 88, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "9", "chr_pos": "107306412", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T88", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs754501431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754501431" }, { "id": "rs754501431", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754501431" }, { "id": "rs754501431", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754501431#frequency_tab" }, { "id": "rs754501431", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754501431" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 91, "end_pos": 91, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "9", "chr_pos": "107306422", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S91", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780635159", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780635159" }, { "id": "rs780635159", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780635159" }, { "id": "rs780635159", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780635159" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 96, "end_pos": 96, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "9", "chr_pos": "107306437", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T96", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 6, "end_pos": 6, "sequence_org": "K", "sequence_mut": "A", "comment": "Impairs interaction with EEF1A1.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "PubMed", "id": "16712842", "url": "https://glygen.org/publication/PubMed/16712842" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "92.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "96.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "95.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "92.83", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "95.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "96.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "96.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "93", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "95.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "97.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "92.68", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "94.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P54727" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "common_name": "Human" } ], "gene": [ { "name": "RAD23B", "url": "https://www.uniprot.org/uniprot/P54727", "locus": { "chromosome": "9", "start_pos": 107332192, "end_pos": 107283137, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000119318", "url": "https://www.ensembl.org/id/ENSG00000119318" } ] } } ], "crossref": [ { "id": "ENSG00000119318", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000119318", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P54727", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P54727", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd14377", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14377", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd14428", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14428", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd16126", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16126", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "RAD23B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RAD23B", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "5887", "url": "https://www.ncbi.nlm.nih.gov/gene/5887", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9813", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9813", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P54727", "url": "https://www.ebi.ac.uk/intact/interactors/id:P54727*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000626", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000626", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006636", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006636", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009060", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009060", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015360", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015360", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015940", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015940", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029071", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029071", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036353", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036353", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041811", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041811", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5887", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5887", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "600062", "url": "http://www.omim.org/entry/600062", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P54727", "url": "https://www.nextprot.org/entry/NX_P54727", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "P54727", "url": "https://oglcnac.org/atlas/detail/P54727", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PHMLEPI", "url": "https://omabrowser.org/oma/group/PHMLEPI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "158575at2759", "url": "http://www.orthodb.org/?query=158575at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10621", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10621", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10621:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10621:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1P1A", "url": "https://www.rcsb.org/structure/1P1A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1PVE", "url": "https://www.rcsb.org/structure/1PVE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UEL", "url": "https://www.rcsb.org/structure/1UEL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EBS", "url": "https://www.rcsb.org/structure/8EBS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EBV", "url": "https://www.rcsb.org/structure/8EBV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EBW", "url": "https://www.rcsb.org/structure/8EBW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00240", "url": "http://pfam.xfam.org/family/PF00240", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00627", "url": "http://pfam.xfam.org/family/PF00627", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09280", "url": "http://pfam.xfam.org/family/PF09280", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P54727", "url": "https://pharos.nih.gov/targets/P54727", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P54727", "url": "http://purl.obolibrary.org/obo/PR_P54727", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5689877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689877", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001231653", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H0Y579", "url": "https://www.uniprot.org/uniprot/H0Y579", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y579-1", "url": "https://www.uniprot.org/uniprot/H0Y579-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P54727-1", "url": "https://www.uniprot.org/uniprot/P54727-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P54727-2", "url": "https://www.uniprot.org/uniprot/P54727-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W0S4", "url": "https://www.uniprot.org/uniprot/Q5W0S4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W0S4-1", "url": "https://www.uniprot.org/uniprot/Q5W0S4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W0S5", "url": "https://www.uniprot.org/uniprot/Q5W0S5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W0S5-1", "url": "https://www.uniprot.org/uniprot/Q5W0S5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED", "length": 409, "header": "sp|P54727-1|RD23B_HUMAN Isoform 1 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1 CANONICAL=P54727-1" }, "isoforms": [ { "isoform_ac": "H0Y579-1", "url": "", "sequence": { "sequence": "XTASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMIIVKTGNKKKKQPLLGK", "length": 114, "header": "tr|H0Y579-1|RD23B_HUMAN Computationally mapped isoform of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1 CANONICAL=P54727-1" }, "locus": { "chromosome": "9", "start_pos": 107331720, "end_pos": 107306542, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000457811.1", "url": "https://www.ensembl.org/id/ENST00000457811.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000396975.1", "url": "https://www.ensembl.org/id/ENSP00000396975.1" } ] } }, { "isoform_ac": "P54727-1", "url": "", "sequence": { "sequence": "MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED", "length": 409, "header": "sp|P54727-1|RD23B_HUMAN Isoform 1 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1 CANONICAL=P54727-1" }, "locus": { "chromosome": "9", "start_pos": 107329653, "end_pos": 107283630, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000358015.8", "url": "https://www.ensembl.org/id/ENST00000358015.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000350708.3", "url": "https://www.ensembl.org/id/ENSP00000350708.3" } ] } }, { "isoform_ac": "P54727-2", "url": "", "sequence": { "sequence": "MVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED", "length": 337, "header": "sp|P54727-2|RD23B_HUMAN Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1 CANONICAL=P54727-1" }, "locus": { "chromosome": "9", "start_pos": 107329653, "end_pos": 107302103, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000416373.6", "url": "https://www.ensembl.org/id/ENST00000416373.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000405623.2", "url": "https://www.ensembl.org/id/ENSP00000405623.2" } ] } }, { "isoform_ac": "Q5W0S4-1", "url": "", "sequence": { "sequence": "MVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTS", "length": 80, "header": "tr|Q5W0S4-1|RD23B_HUMAN Computationally mapped isoform of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1 CANONICAL=P54727-1" }, "locus": { "chromosome": "9", "start_pos": 107306453, "end_pos": 107284911, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000442587.1", "url": "https://www.ensembl.org/id/ENST00000442587.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000415821.1", "url": "https://www.ensembl.org/id/ENSP00000415821.1" } ] } }, { "isoform_ac": "Q5W0S5-1", "url": "", "sequence": { "sequence": "MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQE", "length": 146, "header": "tr|Q5W0S5-1|RD23B_HUMAN Computationally mapped isoform of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1 CANONICAL=P54727-1" }, "locus": { "chromosome": "9", "start_pos": 107306588, "end_pos": 107283630, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000419616.5", "url": "https://www.ensembl.org/id/ENST00000419616.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000416868.1", "url": "https://www.ensembl.org/id/ENSP00000416868.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 100, "start_aa": "Thr", "end_pos": 100, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr100", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 101, "start_aa": "Ser", "end_pos": 101, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser101", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 102, "start_aa": "Ser", "end_pos": 102, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser102", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 104, "start_aa": "Thr", "end_pos": 104, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr104", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 105, "start_aa": "Thr", "end_pos": 105, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr105", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 112, "start_aa": "Thr", "end_pos": 112, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr112", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 127, "start_aa": "Thr", "end_pos": 127, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr127", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 130, "start_aa": "Ser", "end_pos": 130, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser130", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 134, "start_aa": "Ser", "end_pos": 134, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser134", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 135, "start_aa": "Ser", "end_pos": 135, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser135", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 141, "start_aa": "Ser", "end_pos": 141, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser141", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 235, "start_aa": "Ser", "end_pos": 235, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser235", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 246, "start_aa": "Ser", "end_pos": 246, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser246", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 247, "start_aa": "Thr", "end_pos": 247, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr247", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 252, "start_aa": "Ser", "end_pos": 252, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser252", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 253, "start_aa": "Ser", "end_pos": 253, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser253", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 253, "start_aa": "Ser", "end_pos": 253, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser253", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 261, "start_aa": "Thr", "end_pos": 261, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr261", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Thr", "end_pos": 261, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr261", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 262, "start_aa": "Thr", "end_pos": 262, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr262", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 263, "start_aa": "Thr", "end_pos": 263, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr263", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 265, "start_aa": "Thr", "end_pos": 265, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr265", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 266, "start_aa": "Thr", "end_pos": 266, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr266", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 267, "start_aa": "Thr", "end_pos": 267, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr267", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 271, "start_aa": "Ser", "end_pos": 271, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser271", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 88, "start_aa": "Thr", "end_pos": 88, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr88", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 91, "start_aa": "Ser", "end_pos": 91, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser91", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 95, "start_aa": "Ser", "end_pos": 95, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser95", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 96, "start_aa": "Thr", "end_pos": 96, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr96", "evidence": [ { "id": "P54727", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "22967762", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22967762" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P54727", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P54727" } ] } ], "phosphorylation": [ { "start_pos": 155, "end_pos": 155, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "PubMed", "id": "17323924", "url": "https://glygen.org/publication/PubMed/17323924" }, { "database": "iPTMnet", "id": "P54727", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P54727", "url": "http://phospho.elm.eu.org/byAccession/P54727.html" } ], "site_lbl": "Thr155" }, { "start_pos": 159, "end_pos": 159, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P54727", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr159" }, { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P54727", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "P54727", "url": "http://phospho.elm.eu.org/byAccession/P54727.html" } ], "site_lbl": "Ser160" }, { "start_pos": 162, "end_pos": 162, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P54727", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Thr162" }, { "start_pos": 164, "end_pos": 164, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P54727", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Thr164" }, { "start_pos": 174, "end_pos": 174, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "site_lbl": "Ser174" }, { "start_pos": 186, "end_pos": 186, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "site_lbl": "Thr186" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "site_lbl": "Ser199" }, { "start_pos": 202, "end_pos": 202, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "site_lbl": "Tyr202" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Characterization of DNA recognition by the human UV-damaged DNA-binding protein.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Fujiwara Y, Masutani C, Mizukoshi T, Kondo J, Hanaoka F, Iwai S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "10391953", "url": "https://glygen.org/publication/PubMed/10391953" } ] }, { "title": "Interaction of hHR23 with S5a. The ubiquitin-like domain of hHR23 mediates interaction with S5a subunit of 26 S proteasome.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Tanaka K., Maekawa T., Hanaoka F., Sugasawa K., Masutani C., Hoeijmakers J.H., Hiyama H., Yokoi M.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "10488153", "url": "https://glygen.org/publication/PubMed/10488153" } ] }, { "title": "Protein complexes in nucleotide excision repair.", "journal": "Mutation research", "date": "1999", "authors": "Araujo SJ, Wood RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "10526214", "url": "https://glygen.org/publication/PubMed/10526214" } ] }, { "title": "The xeroderma pigmentosum group C protein complex XPC-HR23B plays an important role in the recruitment of transcription factor IIH to damaged DNA.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Yokoi M, Masutani C, Maekawa T, Sugasawa K, Ohkuma Y, Hanaoka F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "10734143", "url": "https://glygen.org/publication/PubMed/10734143" } ] }, { "title": "A novel disorder caused by defective biosynthesis of N-linked oligosaccharides due to glucosidase I deficiency.", "journal": "American journal of human genetics", "date": "2000", "authors": "De Praeter CM, Gerwig GJ, Bause E, Nuytinck LK, Vliegenthart JF, Breuer W, Kamerling JP, Espeel MF, Martin JJ, De Paepe AM, Chan NW, Dacremont GA, Van Coster RN", "evidence": [ { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "10788335", "url": "https://glygen.org/publication/PubMed/10788335" } ] }, { "title": "Stable binding of human XPC complex to irradiated DNA confers strong discrimination for damaged sites.", "journal": "J. Mol. Biol.", "date": "2000", "authors": "Levine A.S., Wood R.D., Batty D., Rapic'-Otrin V.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "10873465", "url": "https://glygen.org/publication/PubMed/10873465" } ] }, { "title": "Ataxin-3, the MJD1 gene product, interacts with the two human homologs of yeast DNA repair protein RAD23, HHR23A and HHR23B.", "journal": "Hum. Mol. Genet.", "date": "2000", "authors": "Wang G, Sawai N, Kotliarova S, Kanazawa I, Nukina N", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "Reactome", "id": "R-HSA-5689877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689877" } ], "reference": [ { "type": "PubMed", "id": "10915768", "url": "https://glygen.org/publication/PubMed/10915768" } ] }, { "title": "The heterodimeric structure of glucosidase II is required for its activity, solubility, and localization in vivo.", "journal": "Glycobiology", "date": "2000", "authors": "Pelletier MF, Marcil A, Sevigny G, Jakob CA, Tessier DC, Chevet E, Menard R, Bergeron JJ, Thomas DY", "evidence": [ { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "10929008", "url": "https://glygen.org/publication/PubMed/10929008" } ] }, { "title": "Molecular structure of human TFIIH.", "journal": "Cell", "date": "2000", "authors": "Schultz P, Fribourg S, Poterszman A, Mallouh V, Moras D, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "11007478", "url": "https://glygen.org/publication/PubMed/11007478" } ] }, { "title": "Novel functional interactions between nucleotide excision DNA repair proteins influencing the enzymatic activities of TFIIH, XPG, and ERCC1-XPF.", "journal": "Biochemistry", "date": "2001", "authors": "Winkler GS, Sugasawa K, Eker AP, de Laat WL, Hoeijmakers JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "11141066", "url": "https://glygen.org/publication/PubMed/11141066" } ] }, { "title": "Damaged DNA-binding protein DDB stimulates the excision of cyclobutane pyrimidine dimers in vitro in concert with XPA and replication protein A.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wakasugi M, Shimizu M, Morioka H, Linn S, Nikaido O, Matsunaga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "11278856", "url": "https://glygen.org/publication/PubMed/11278856" } ] }, { "title": "Centrosome protein centrin 2/caltractin 1 is part of the xeroderma pigmentosum group C complex that initiates global genome nucleotide excision repair.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Araki M, Masutani C, Takemura M, Uchida A, Sugasawa K, Kondoh J, Ohkuma Y, Hanaoka F", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "11279143", "url": "https://glygen.org/publication/PubMed/11279143" } ] }, { "title": "Sequential assembly of the nucleotide excision repair factors in vivo.", "journal": "Molecular cell", "date": "2001", "authors": "Volker M, Mone MJ, Karmakar P, van Hoffen A, Schul W, Vermeulen W, Hoeijmakers JH, van Driel R, van Zeeland AA, Mullenders LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "11511374", "url": "https://glygen.org/publication/PubMed/11511374" } ] }, { "title": "p52 Mediates XPB function within the transcription/repair factor TFIIH.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Jawhari A, Laine JP, Dubaele S, Lamour V, Poterszman A, Coin F, Moras D, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "12080057", "url": "https://glygen.org/publication/PubMed/12080057" } ] }, { "title": "Endo-beta-N-acetylglucosaminidase, an enzyme involved in processing of free oligosaccharides in the cytosol.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Suzuki T, Yano K, Sugimoto S, Kitajima K, Lennarz WJ, Inoue S, Inoue Y, Emori Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "12114544", "url": "https://glygen.org/publication/PubMed/12114544" } ] }, { "title": "Processing of N-linked carbohydrate chains in a patient with glucosidase I deficiency (CDG type IIb).", "journal": "Glycobiology", "date": "2002", "authors": "Volker C, De Praeter CM, Hardt B, Breuer W, Kalz-Fuller B, Van Coster RN, Bause E", "evidence": [ { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "12145188", "url": "https://glygen.org/publication/PubMed/12145188" } ] }, { "title": "The carboxy-terminal domain of the XPC protein plays a crucial role in nucleotide excision repair through interactions with transcription factor IIH.", "journal": "DNA Repair", "date": "2002", "authors": "Uchida A., Hanaoka F., Sugasawa K., Dohmae N., Araki M., Masutani C., Ohkuma Y., Yokoi M.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "12509233", "url": "https://glygen.org/publication/PubMed/12509233" } ] }, { "title": "A molecular mechanism for DNA damage recognition by the xeroderma pigmentosum group C protein complex.", "journal": "DNA Repair", "date": "2002", "authors": "Iwai S., Shimizu Y., Hanaoka F., Sugasawa K.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "12509299", "url": "https://glygen.org/publication/PubMed/12509299" } ] }, { "title": "DNA bending by the human damage recognition complex XPC-HR23B.", "journal": "DNA Repair", "date": "2003", "authors": "Shimizu Y., Hanaoka F., Sugasawa K., Wyman C., Hoeijmakers J.H., Wijgers N., Djurica M., Janicijevic A.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "12547395", "url": "https://glygen.org/publication/PubMed/12547395" } ] }, { "title": "The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.", "journal": "Cell", "date": "2003", "authors": "Groisman R, Polanowska J, Kuraoka I, Sawada J, Saijo M, Drapkin R, Kisselev AF, Tanaka K, Nakatani Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "12732143", "url": "https://glygen.org/publication/PubMed/12732143" } ] }, { "title": "A novel regulation mechanism of DNA repair by damage-induced and RAD23-dependent stabilization of xeroderma pigmentosum group C protein.", "journal": "Genes Dev.", "date": "2003", "authors": "Ng JM, Vermeulen W, van der Horst GT, Bergink S, Sugasawa K, Vrieling H, Hoeijmakers JH", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "12815074", "url": "https://glygen.org/publication/PubMed/12815074" } ] }, { "title": "Binding surface mapping of intra- and interdomain interactions among hHR23B, ubiquitin, and polyubiquitin binding site 2 of S5a.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Lee K.-J., Bae S.-H., Choi B.-S., Kim B.-K., Kim K.-A., Ryu K.-S.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "12832454", "url": "https://glygen.org/publication/PubMed/12832454" } ] }, { "title": "In vivo recruitment of XPC to UV-induced cyclobutane pyrimidine dimers by the DDB2 gene product.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Fitch ME, Nakajima S, Yasui A, Ford JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "12944386", "url": "https://glygen.org/publication/PubMed/12944386" } ] }, { "title": "The comings and goings of nucleotide excision repair factors on damaged DNA.", "journal": "The EMBO journal", "date": "2003", "authors": "Riedl T, Hanaoka F, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "14517266", "url": "https://glygen.org/publication/PubMed/14517266" } ] }, { "title": "Structure of the ubiquitin-interacting motif of S5a bound to the ubiquitin-like domain of HR23B.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Ohki I., Shirakawa M., Tochio H., Hanaoka F., Sugasawa K., Kojima C., Fujiwara K., Hiroaki H., Tenno T., Jee J.-G.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "14585839", "url": "https://glygen.org/publication/PubMed/14585839" } ] }, { "title": "UV radiation-induced XPC translocation within chromatin is mediated by damaged-DNA binding protein, DDB2.", "journal": "Carcinogenesis", "date": "2004", "authors": "Wang QE, Zhu Q, Wani G, Chen J, Wani AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "14742321", "url": "https://glygen.org/publication/PubMed/14742321" } ] }, { "title": "Expression of a novel RAD23B mRNA splice variant in the human testis.", "journal": "J. Androl.", "date": "2004", "authors": "Huang X., Li J., Wang H., Lu L., Xu Z., Zhou Z., Xu M., Sha J.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "15064313", "url": "https://glygen.org/publication/PubMed/15064313" } ] }, { "title": "A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol.", "journal": "Nature", "date": "2004", "authors": "Ye Y, Shibata Y, Yun C, Ron D, Rapoport TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "15215856", "url": "https://glygen.org/publication/PubMed/15215856" } ] }, { "title": "A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.", "journal": "Nature genetics", "date": "2004", "authors": "Giglia-Mari G, Coin F, Ranish JA, Hoogstraten D, Theil A, Wijgers N, Jaspers NG, Raams A, Argentini M, van der Spek PJ, Botta E, Stefanini M, Egly JM, Aebersold R, Hoeijmakers JH, Vermeulen W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "15220921", "url": "https://glygen.org/publication/PubMed/15220921" } ] }, { "title": "A complex between peptide:N-glycanase and two proteasome-linked proteins suggests a mechanism for the degradation of misfolded glycoproteins.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Katiyar S, Li G, Lennarz WJ", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "15358861", "url": "https://glygen.org/publication/PubMed/15358861" } ] }, { "title": "A novel UBA and UBX domain protein that binds polyubiquitin and VCP and is a substrate for SAPKs.", "journal": "The Biochemical journal", "date": "2004", "authors": "McNeill H, Knebel A, Arthur JS, Cuenda A, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "15362974", "url": "https://glygen.org/publication/PubMed/15362974" } ] }, { "title": "The spacer region of XPG mediates recruitment to nucleotide excision repair complexes and determines substrate specificity.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Dunand-Sauthier I, Hohl M, Thorel F, Jaquier-Gubler P, Clarkson SG, Scharer OD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "15590680", "url": "https://glygen.org/publication/PubMed/15590680" } ] }, { "title": "The UV-damaged DNA binding protein mediates efficient targeting of the nucleotide excision repair complex to UV-induced photo lesions.", "journal": "DNA repair", "date": "2005", "authors": "Moser J, Volker M, Kool H, Alekseev S, Vrieling H, Yasui A, van Zeeland AA, Mullenders LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "15811629", "url": "https://glygen.org/publication/PubMed/15811629" } ] }, { "title": "UV-induced ubiquitylation of XPC protein mediated by UV-DDB-ubiquitin ligase complex.", "journal": "Cell", "date": "2005", "authors": "Sugasawa K, Okuda Y, Saijo M, Nishi R, Matsuda N, Chu G, Mori T, Iwai S, Tanaka K, Tanaka K, Hanaoka F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "15882621", "url": "https://glygen.org/publication/PubMed/15882621" } ] }, { "title": "Solution structure and backbone dynamics of the XPC-binding domain of the human DNA repair protein hHR23B.", "journal": "FEBS J.", "date": "2005", "authors": "Kim B., Kim H.-J., Cho S.-J., Choi B.-S., Ryu K.-S.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "15885096", "url": "https://glygen.org/publication/PubMed/15885096" } ] }, { "title": "Centrin 2 stimulates nucleotide excision repair by interacting with xeroderma pigmentosum group C protein.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Nishi R, Okuda Y, Watanabe E, Mori T, Iwai S, Masutani C, Sugasawa K, Hanaoka F", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "15964821", "url": "https://glygen.org/publication/PubMed/15964821" } ] }, { "title": "DNA repair factor XPC is modified by SUMO-1 and ubiquitin following UV irradiation.", "journal": "Nucleic acids research", "date": "2005", "authors": "Wang QE, Zhu Q, Wani G, El-Mahdy MA, Li J, Wani AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "16030353", "url": "https://glygen.org/publication/PubMed/16030353" } ] }, { "title": "The retrotranslocation protein Derlin-1 binds peptide:N-glycanase to the endoplasmic reticulum.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Katiyar S, Joshi S, Lennarz WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "16055502", "url": "https://glygen.org/publication/PubMed/16055502" } ] }, { "title": "Gp78, a membrane-anchored ubiquitin ligase, associates with Insig-1 and couples sterol-regulated ubiquitination to degradation of HMG CoA reductase.", "journal": "Molecular cell", "date": "2005", "authors": "Song BL, Sever N, DeBose-Boyd RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "16168377", "url": "https://glygen.org/publication/PubMed/16168377" } ] }, { "title": "DDB1-DDB2 (xeroderma pigmentosum group E) protein complex recognizes a cyclobutane pyrimidine dimer, mismatches, apurinic/apyrimidinic sites, and compound lesions in DNA.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Wittschieben BO, Iwai S, Wood RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "16223728", "url": "https://glygen.org/publication/PubMed/16223728" } ] }, { "title": "Studies on the intracellular localization of hHR23B.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2005", "authors": "Katiyar S., Lennarz W.J.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "16253613", "url": "https://glygen.org/publication/PubMed/16253613" } ] }, { "title": "The DDB1-CUL4ADDB2 ubiquitin ligase is deficient in xeroderma pigmentosum group E and targets histone H2A at UV-damaged DNA sites.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Kapetanaki MG, Guerrero-Santoro J, Bisi DC, Hsieh CL, Rapic-Otrin V, Levine AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "16473935", "url": "https://glygen.org/publication/PubMed/16473935" } ] }, { "title": "Recognition of helical kinks by xeroderma pigmentosum group A protein triggers DNA excision repair.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Camenisch U, Dip R, Schumacher SB, Schuler B, Naegeli H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "16491090", "url": "https://glygen.org/publication/PubMed/16491090" } ] }, { "title": "Histone H3 and H4 ubiquitylation by the CUL4-DDB-ROC1 ubiquitin ligase facilitates cellular response to DNA damage.", "journal": "Molecular cell", "date": "2006", "authors": "Wang H, Zhai L, Xu J, Joo HY, Jackson S, Erdjument-Bromage H, Tempst P, Xiong Y, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "16678110", "url": "https://glygen.org/publication/PubMed/16678110" } ] }, { "title": "Evidence for distinct functions for human DNA repair factors hHR23A and hHR23B.", "journal": "FEBS Lett.", "date": "2006", "authors": "Chen L, Madura K", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "16712842", "url": "https://glygen.org/publication/PubMed/16712842" } ] }, { "title": "Recruitment of the nucleotide excision repair endonuclease XPG to sites of UV-induced dna damage depends on functional TFIIH.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Zotter A, Luijsterburg MS, Warmerdam DO, Ibrahim S, Nigg A, van Cappellen WA, Hoeijmakers JH, van Driel R, Vermeulen W, Houtsmuller AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "17000769", "url": "https://glygen.org/publication/PubMed/17000769" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "H0Y579", "url": "https://www.uniprot.org/uniprot/H0Y579" }, { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.", "journal": "Biochemistry", "date": "2007", "authors": "Wang X, Chen CF, Baker PR, Chen PL, Kaiser P, Huang L", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "UniProtKB", "id": "Q5W0S4", "url": "https://www.uniprot.org/uniprot/Q5W0S4" }, { "database": "UniProtKB", "id": "Q5W0S5", "url": "https://www.uniprot.org/uniprot/Q5W0S5" }, { "database": "UniProtKB", "id": "H0Y579", "url": "https://www.uniprot.org/uniprot/H0Y579" }, { "database": "iPTMnet", "id": "P54727", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727" } ], "reference": [ { "type": "PubMed", "id": "17323924", "url": "https://glygen.org/publication/PubMed/17323924" } ] }, { "title": "XPG stabilizes TFIIH, allowing transactivation of nuclear receptors: implications for Cockayne syndrome in XP-G/CS patients.", "journal": "Molecular cell", "date": "2007", "authors": "Ito S, Kuraoka I, Chymkowitch P, Compe E, Takedachi A, Ishigami C, Coin F, Egly JM, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "17466625", "url": "https://glygen.org/publication/PubMed/17466625" } ] }, { "title": "Distinct roles for the XPB/p52 and XPD/p44 subcomplexes of TFIIH in damaged DNA opening during nucleotide excision repair.", "journal": "Molecular cell", "date": "2007", "authors": "Coin F, Oksenych V, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "17466626", "url": "https://glygen.org/publication/PubMed/17466626" } ] }, { "title": "Josephin domain-containing proteins from a variety of species are active de-ubiquitination enzymes.", "journal": "Biological chemistry", "date": "2007", "authors": "Tzvetkov N, Breuer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689877" } ], "reference": [ { "type": "PubMed", "id": "17696782", "url": "https://glygen.org/publication/PubMed/17696782" } ] }, { "title": "Recognition of DNA damage by the Rad4 nucleotide excision repair protein.", "journal": "Nature", "date": "2007", "authors": "Min JH, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "17882165", "url": "https://glygen.org/publication/PubMed/17882165" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA.", "journal": "The EMBO journal", "date": "2007", "authors": "Tsodikov OV, Ivanov D, Orelli B, Staresincic L, Shoshani I, Oberman R, Scharer OD, Wagner G, Ellenberger T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "17948053", "url": "https://glygen.org/publication/PubMed/17948053" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Malectin: a novel carbohydrate-binding protein of the endoplasmic reticulum and a candidate player in the early steps of protein N-glycosylation.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Schallus T, Jaeckh C, Feher K, Palma AS, Liu Y, Simpson JC, Mackeen M, Stier G, Gibson TJ, Feizi T, Pieler T, Muhle-Goll C", "evidence": [ { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "18524852", "url": "https://glygen.org/publication/PubMed/18524852" } ] }, { "title": "The deubiquitinating enzyme ataxin-3, a polyglutamine disease protein, edits Lys63 linkages in mixed linkage ubiquitin chains.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Winborn BJ, Travis SM, Todi SV, Scaglione KM, Xu P, Williams AJ, Cohen RE, Peng J, Paulson HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689877" } ], "reference": [ { "type": "PubMed", "id": "18599482", "url": "https://glygen.org/publication/PubMed/18599482" } ] }, { "title": "Nucleotide excision repair driven by the dissociation of CAK from TFIIH.", "journal": "Molecular cell", "date": "2008", "authors": "Coin F, Oksenych V, Mocquet V, Groh S, Blattner C, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "18614043", "url": "https://glygen.org/publication/PubMed/18614043" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Mol. Cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "H0Y579", "url": "https://www.uniprot.org/uniprot/H0Y579" }, { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Physical and functional interaction between DDB and XPA in nucleotide excision repair.", "journal": "Nucleic acids research", "date": "2009", "authors": "Wakasugi M, Kasashima H, Fukase Y, Imura M, Imai R, Yamada S, Cleaver JE, Matsunaga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "19056823", "url": "https://glygen.org/publication/PubMed/19056823" } ] }, { "title": "Structural basis of UV DNA-damage recognition by the DDB1-DDB2 complex.", "journal": "Cell", "date": "2008", "authors": "Scrima A, Konickova R, Czyzewski BK, Kawasaki Y, Jeffrey PD, Groisman R, Nakatani Y, Iwai S, Pavletich NP, Thoma NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "19109893", "url": "https://glygen.org/publication/PubMed/19109893" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "Variably modulated gating of the 26S proteasome by ATP and polyubiquitin.", "journal": "Biochem. J.", "date": "2009", "authors": "Li X., Demartino G.N.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "19435460", "url": "https://glygen.org/publication/PubMed/19435460" } ] }, { "title": "Two-stage dynamic DNA quality check by xeroderma pigmentosum group C protein.", "journal": "The EMBO journal", "date": "2009", "authors": "Camenisch U, Trautlein D, Clement FC, Fei J, Leitenstorfer A, Ferrando-May E, Naegeli H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "19609301", "url": "https://glygen.org/publication/PubMed/19609301" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Poly(ADP-ribose)-dependent regulation of DNA repair by the chromatin remodeling enzyme ALC1.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Ahel D, Horejsi Z, Wiechens N, Polo SE, Garcia-Wilson E, Ahel I, Flynn H, Skehel M, West SC, Jackson SP, Owen-Hughes T, Boulton SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "19661379", "url": "https://glygen.org/publication/PubMed/19661379" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "iPTMnet", "id": "P54727", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Molecular insights into the recruitment of TFIIH to sites of DNA damage.", "journal": "The EMBO journal", "date": "2009", "authors": "Oksenych V, Bernardes de Jesus B, Zhovmer A, Egly JM, Coin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "19713942", "url": "https://glygen.org/publication/PubMed/19713942" } ] }, { "title": "The XPA-binding domain of ERCC1 is required for nucleotide excision repair but not other DNA repair pathways.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Orelli B, McClendon TB, Tsodikov OV, Ellenberger T, Niedernhofer LJ, Scharer OD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "19940136", "url": "https://glygen.org/publication/PubMed/19940136" } ] }, { "title": "Two-step recognition of DNA damage for mammalian nucleotide excision repair: Directional binding of the XPC complex and DNA strand scanning.", "journal": "Mol. Cell", "date": "2009", "authors": "Sugasawa K, Akagi J, Nishi R, Iwai S, Hanaoka F", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "19941824", "url": "https://glygen.org/publication/PubMed/19941824" } ] }, { "title": "Photo-cross-linking of XPC-Rad23B to cisplatin-damaged DNA reveals contacts with both strands of the DNA duplex and spans the DNA adduct.", "journal": "Biochemistry", "date": "2010", "authors": "Lavrik O.I., Neher T.M., Rechkunova N.I., Turchi J.J.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "20028083", "url": "https://glygen.org/publication/PubMed/20028083" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "iPTMnet", "id": "P54727-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "DDB2 complex-mediated ubiquitylation around DNA damage is oppositely regulated by XPC and Ku and contributes to the recruitment of XPA.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Takedachi A, Saijo M, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "20368362", "url": "https://glygen.org/publication/PubMed/20368362" } ] }, { "title": "Stimulation of DNA glycosylase activities by XPC Protein Complex: Roles of protein-protein interactions.", "journal": "J. Nucleic Acids", "date": "2010", "authors": "Shimizu Y., Saitoh H., Hanaoka F., Sugasawa K., Dohmae N., Uchimura Y.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "20798892", "url": "https://glygen.org/publication/PubMed/20798892" } ] }, { "title": "INO80 chromatin remodeling complex promotes the removal of UV lesions by the nucleotide excision repair pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Jiang Y, Wang X, Bao S, Guo R, Johnson DG, Shen X, Li L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "20855601", "url": "https://glygen.org/publication/PubMed/20855601" } ] }, { "title": "Strand- and site-specific DNA lesion demarcation by the xeroderma pigmentosum group D helicase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Mathieu N, Kaczmarek N, Naegeli H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "20876134", "url": "https://glygen.org/publication/PubMed/20876134" } ] }, { "title": "The Machado-Joseph disease-associated mutant form of ataxin-3 regulates parkin ubiquitination and stability.", "journal": "Human molecular genetics", "date": "2011", "authors": "Durcan TM, Kontogiannea M, Thorarinsdottir T, Fallon L, Williams AJ, Djarmati A, Fantaneanu T, Paulson HL, Fon EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689877" } ], "reference": [ { "type": "PubMed", "id": "20940148", "url": "https://glygen.org/publication/PubMed/20940148" } ] }, { "title": "The Ino80 chromatin-remodeling complex restores chromatin structure during UV DNA damage repair.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Sarkar S, Kiely R, McHugh PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "21135142", "url": "https://glygen.org/publication/PubMed/21135142" } ] }, { "title": "Nucleotide excision repair proteins rapidly accumulate but fail to persist in human XP-E (DDB2 mutant) cells.", "journal": "Photochemistry and photobiology", "date": "2011", "authors": "Oh KS, Imoto K, Emmert S, Tamura D, DiGiovanna JJ, Kraemer KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "21388382", "url": "https://glygen.org/publication/PubMed/21388382" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "iPTMnet", "id": "P54727", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Temporal dissection of tumorigenesis in primary cancers.", "journal": "Cancer discovery", "date": "2011", "authors": "Durinck S, Ho C, Wang NJ, Liao W, Jakkula LR, Collisson EA, Pons J, Chan SW, Lam ET, Chu C, Park K, Hong SW, Hur JS, Huh N, Neuhaus IM, Yu SS, Grekin RC, Mauro TM, Cleaver JE, Kwok PY, LeBoit PE, Getz G, Cibulskis K, Aster JC, Huang H, Purdom E, Li J, Bolund L, Arron ST, Gray JW, Spellman PT, Cho RJ", "evidence": [ { "database": "dbSNP", "id": "rs1443425269", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1443425269" } ], "reference": [ { "type": "PubMed", "id": "21984974", "url": "https://glygen.org/publication/PubMed/21984974" } ] }, { "title": "Functional and structural studies of the nucleotide excision repair helicase XPD suggest a polarity for DNA translocation.", "journal": "The EMBO journal", "date": "2012", "authors": "Kuper J, Wolski SC, Michels G, Kisker C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "22081108", "url": "https://glygen.org/publication/PubMed/22081108" } ] }, { "title": "The molecular basis of CRL4DDB2/CSA ubiquitin ligase architecture, targeting, and activation.", "journal": "Cell", "date": "2011", "authors": "Fischer ES, Scrima A, Bohm K, Matsumoto S, Lingaraju GM, Faty M, Yasuda T, Cavadini S, Wakasugi M, Hanaoka F, Iwai S, Gut H, Sugasawa K, Thoma NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "22118460", "url": "https://glygen.org/publication/PubMed/22118460" } ] }, { "title": "Discovery of O-GlcNAc-modified proteins in published large-scale proteome data.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Hahne H, Gholami AM, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "database": "O-GlcNAc Atlas", "id": "P54727", "url": "https://oglcnac.org/atlas/detail/P54727" } ], "reference": [ { "type": "PubMed", "id": "22661428", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "title": "Characterization of O-GlcNAc cycling and proteomic identification of differentially O-GlcNAcylated proteins during G1/S transition.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Drougat L, Olivier-Van Stichelen S, Mortuaire M, Foulquier F, Lacoste AS, Michalski JC, Lefebvre T, Vercoutter-Edouart AS", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" } ], "reference": [ { "type": "PubMed", "id": "22967762", "url": "https://glygen.org/publication/PubMed/22967762" } ] }, { "title": "Poly(ADP-ribose) contributes to an association between poly(ADP-ribose) polymerase-1 and xeroderma pigmentosum complementation group A in nucleotide excision repair.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "King BS, Cooper KL, Liu KJ, Hudson LG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "23038248", "url": "https://glygen.org/publication/PubMed/23038248" } ] }, { "title": "PARP1 promotes nucleotide excision repair through DDB2 stabilization and recruitment of ALC1.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Pines A, Vrouwe MG, Marteijn JA, Typas D, Luijsterburg MS, Cansoy M, Hensbergen P, Deelder A, de Groot A, Matsumoto S, Sugasawa K, Thoma N, Vermeulen W, Vrieling H, Mullenders L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "23045548", "url": "https://glygen.org/publication/PubMed/23045548" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "iPTMnet", "id": "P54727", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Role of poly(ADP-ribose) polymerase-1 in the removal of UV-induced DNA lesions by nucleotide excision repair.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Robu M, Shah RG, Petitclerc N, Brind'Amour J, Kandan-Kulangara F, Shah GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "23319653", "url": "https://glygen.org/publication/PubMed/23319653" } ] }, { "title": "DNA quality control by a lesion sensor pocket of the xeroderma pigmentosum group D helicase subunit of TFIIH.", "journal": "Current biology : CB", "date": "2013", "authors": "Mathieu N, Kaczmarek N, Ruthemann P, Luch A, Naegeli H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "23352696", "url": "https://glygen.org/publication/PubMed/23352696" } ] }, { "title": "RNF111/Arkadia is a SUMO-targeted ubiquitin ligase that facilitates the DNA damage response.", "journal": "The Journal of cell biology", "date": "2013", "authors": "Poulsen SL, Hansen RK, Wagner SA, van Cuijk L, van Belle GJ, Streicher W, Wikstrom M, Choudhary C, Houtsmuller AB, Marteijn JA, Bekker-Jensen S, Mailand N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "23751493", "url": "https://glygen.org/publication/PubMed/23751493" } ] }, { "title": "Genetic polymorphisms in RAD23B and XPC modulate DNA repair capacity and breast cancer risk in Puerto Rican women.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Perez-Mayoral J, Pacheco-Torres AL, Morales L, Acosta-Rodriguez H, Matta JL, Dutil J", "evidence": [ { "database": "Entrez", "id": "5887", "url": "https://www.ncbi.nlm.nih.gov/gene/5887" } ], "reference": [ { "type": "PubMed", "id": "23776089", "url": "https://glygen.org/publication/PubMed/23776089" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "iPTMnet", "id": "P54727", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54727" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Sequential and ordered assembly of a large DNA repair complex on undamaged chromatin.", "journal": "The Journal of cell biology", "date": "2014", "authors": "Ziani S, Nagy Z, Alekseev S, Soutoglou E, Egly JM, Coin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "25154395", "url": "https://glygen.org/publication/PubMed/25154395" } ] }, { "title": "USP45 deubiquitylase controls ERCC1-XPF endonuclease-mediated DNA damage responses.", "journal": "The EMBO journal", "date": "2015", "authors": "Perez-Oliva AB, Lachaud C, Szyniarowski P, Munoz I, Macartney T, Hickson I, Rouse J, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "25538220", "url": "https://glygen.org/publication/PubMed/25538220" } ] }, { "title": "SUMOylation of xeroderma pigmentosum group C protein regulates DNA damage recognition during nucleotide excision repair.", "journal": "Scientific reports", "date": "2015", "authors": "Akita M, Tak YS, Shimura T, Matsumoto S, Okuda-Shimizu Y, Shimizu Y, Nishi R, Saitoh H, Iwai S, Mori T, Ikura T, Sakai W, Hanaoka F, Sugasawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "26042670", "url": "https://glygen.org/publication/PubMed/26042670" } ] }, { "title": "SUMO and ubiquitin-dependent XPC exchange drives nucleotide excision repair.", "journal": "Nature communications", "date": "2015", "authors": "van Cuijk L, van Belle GJ, Turkyilmaz Y, Poulsen SL, Janssens RC, Theil AF, Sabatella M, Lans H, Mailand N, Houtsmuller AB, Vermeulen W, Marteijn JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "26151477", "url": "https://glygen.org/publication/PubMed/26151477" } ] }, { "title": "The cytoplasmic peptide:N-glycanase (NGLY1) - Structure, expression and cellular functions.", "journal": "Gene", "date": "2016", "authors": "Suzuki T, Huang C, Fujihira H", "evidence": [ { "database": "Reactome", "id": "R-HSA-532668", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668" } ], "reference": [ { "type": "PubMed", "id": "26611529", "url": "https://glygen.org/publication/PubMed/26611529" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" }, { "database": "O-GlcNAc Atlas", "id": "P54727", "url": "https://oglcnac.org/atlas/detail/P54727" }, { "database": "GlyGen", "id": "GLY_000142", "url": "https://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Physiological and pathophysiological characteristics of ataxin-3 isoforms.", "journal": "J. Biol. Chem.", "date": "2019", "authors": "Weishaupl D, Schneider J, Peixoto Pinheiro B, Ruess C, Dold SM, von Zweydorf F, Gloeckner CJ, Schmidt J, Riess O, Schmidt T", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "30455355", "url": "https://glygen.org/publication/PubMed/30455355" } ] }, { "title": "Aspartate Residues Far from the Active Site Drive O-GlcNAc Transferase Substrate Selection.", "journal": "Journal of the American Chemical Society", "date": "2019", "authors": "Joiner CM, Levine ZG, Aonbangkhen C, Woo CM, Walker S", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P54727", "url": "https://oglcnac.org/atlas/detail/P54727" } ], "reference": [ { "type": "PubMed", "id": "31373491", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Tandem Bioorthogonal Labeling Uncovers Endogenous Cotranslationally O-GlcNAc Modified Nascent Proteins.", "journal": "Journal of the American Chemical Society", "date": "2020", "authors": "Zhu Y, Willems LI, Salas D, Cecioni S, Wu WB, Foster LJ, Vocadlo DJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" } ], "reference": [ { "type": "PubMed", "id": "32870666", "url": "https://glygen.org/publication/PubMed/32870666" } ] }, { "title": "Methods for Enrichment and Assignment of N-Acetylglucosamine Modification Sites.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Maynard JC, Chalkley RJ", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P54727", "url": "https://oglcnac.org/atlas/detail/P54727" } ], "reference": [ { "type": "PubMed", "id": "32938750", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Cytoplasmic RAD23B interacts with CORO1C to synergistically promote colorectal cancer progression and metastasis.", "journal": "Cancer letters", "date": "2021", "authors": "Li J, Tian L, Jing Z, Guo Z, Nan P, Liu F, Zou S, Yang L, Xie X, Zhu Y, Zhao Y, Sun W, Sun Y, Zhao X", "evidence": [ { "database": "RefSeq", "id": "NP_001231653", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653" } ], "reference": [ { "type": "PubMed", "id": "34062216", "url": "https://glygen.org/publication/PubMed/34062216" } ] }, { "title": "Deubiquitinase PSMD7 promotes the proliferation, invasion, and cisplatin resistance of gastric cancer cells by stabilizing RAD23B.", "journal": "International journal of biological sciences", "date": "2021", "authors": "Wang J, Liu R, Mo H, Xiao X, Xu Q, Zhao W", "evidence": [ { "database": "RefSeq", "id": "NP_001231653", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231653" } ], "reference": [ { "type": "PubMed", "id": "34512150", "url": "https://glygen.org/publication/PubMed/34512150" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "4-Deoxy-4-fluoro-GalNAz (4FGalNAz) Is a Metabolic Chemical Reporter of O-GlcNAc Modifications, Highlighting the Notable Substrate Flexibility of O-GlcNAc Transferase.", "journal": "ACS chemical biology", "date": "2022", "authors": "Jackson EG, Cutolo G, Yang B, Yarravarapu N, Burns MWN, Bineva-Todd G, Roustan C, Thoden JB, Lin-Jones HM, van Kuppevelt TH, Holden HM, Schumann B, Kohler JJ, Woo CM, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" } ], "reference": [ { "type": "PubMed", "id": "34931806", "url": "https://glygen.org/publication/PubMed/34931806" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P54727", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54727" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Purification and characterization of the XPF-ERCC1 complex of human DNA repair excision nuclease.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Park CH, Bessho T, Matsunaga T, Sancar A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "7559382", "url": "https://glygen.org/publication/PubMed/7559382" } ] }, { "title": "RPA involvement in the damage-recognition and incision steps of nucleotide excision repair.", "journal": "Nature", "date": "1995", "authors": "He Z, Henricksen LA, Wold MS, Ingles CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "7700386", "url": "https://glygen.org/publication/PubMed/7700386" } ] }, { "title": "Purification and cloning of a nucleotide excision repair complex involving the Xeroderma pigmentosum group C protein and a human homologue of yeast RAD23.", "journal": "EMBO J.", "date": "1994", "authors": "Masutani C, Sugasawa K, Yanagisawa J, Sonoyama T, Ui M, Enomoto T, Takio K, Tanaka K, van der Spek PJ, Bootsma D, et al.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" }, { "database": "Reactome", "id": "R-HSA-5696394", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394" } ], "reference": [ { "type": "PubMed", "id": "8168482", "url": "https://glygen.org/publication/PubMed/8168482" } ] }, { "title": "Isolation and characterization of two human transcription factor IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Reardon JT, Ge H, Gibbs E, Sancar A, Hurwitz J, Pan ZQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "8692841", "url": "https://glygen.org/publication/PubMed/8692841" } ] }, { "title": "Substrate specificity of the cdk-activating kinase (CAK) is altered upon association with TFIIH.", "journal": "The EMBO journal", "date": "1997", "authors": "Rossignol M, Kolb-Cheynel I, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "9130708", "url": "https://glygen.org/publication/PubMed/9130708" } ] }, { "title": "Two human homologs of Rad23 are functionally interchangeable in complex formation and stimulation of XPC repair activity.", "journal": "Mol. Cell. Biol.", "date": "1997", "authors": "van der Spek P.J., Maekawa T., Uchida A., Hanaoka F., Sugasawa K., Masutani C., Hoeijmakers J.H., Bootsma D., Wood R.D., Rademakers S., Aboussekhra A., Eker A.P., Ng J.M., Visser C.", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "9372924", "url": "https://glygen.org/publication/PubMed/9372924" } ] }, { "title": "Solution structure of the DNA- and RPA-binding domain of the human repair factor XPA.", "journal": "Nature structural biology", "date": "1998", "authors": "Ikegami T, Kuraoka I, Saijo M, Kodo N, Kyogoku Y, Morikawa K, Tanaka K, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "9699634", "url": "https://glygen.org/publication/PubMed/9699634" } ] }, { "title": "DNA-binding polarity of human replication protein A positions nucleases in nucleotide excision repair.", "journal": "Genes & development", "date": "1998", "authors": "de Laat WL, Appeldoorn E, Sugasawa K, Weterings E, Jaspers NG, Hoeijmakers JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "9716411", "url": "https://glygen.org/publication/PubMed/9716411" } ] }, { "title": "Xeroderma pigmentosum group C protein complex is the initiator of global genome nucleotide excision repair.", "journal": "Mol. Cell", "date": "1998", "authors": "Sugasawa K, Ng JM, Masutani C, Iwai S, van der Spek PJ, Eker AP, Hanaoka F, Bootsma D, Hoeijmakers JH", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "reference": [ { "type": "PubMed", "id": "9734359", "url": "https://glygen.org/publication/PubMed/9734359" } ] }, { "title": "Mutations in the XPD helicase gene result in XP and TTD phenotypes, preventing interaction between XPD and the p44 subunit of TFIIH.", "journal": "Nature genetics", "date": "1998", "authors": "Coin F, Marinoni JC, Rodolfo C, Fribourg S, Pedrini AM, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5696395", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395" } ], "reference": [ { "type": "PubMed", "id": "9771713", "url": "https://glygen.org/publication/PubMed/9771713" } ] } ], "pathway": [ { "id": "hsa:5887", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5887", "resource": "KEGG Pathway" }, { "id": "R-HSA-532668", "name": "N-glycan trimming in the ER and Calnexin/Calreticulin cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-532668", "resource": "Reactome", "description": "N-glycan trimming in the ER and Calnexin/Calreticulin cycle" }, { "id": "R-HSA-5689877", "name": "Josephin domain DUBs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689877", "resource": "Reactome", "description": "Josephin domain DUBs" }, { "id": "R-HSA-5696394", "name": "DNA Damage Recognition in GG-NER", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696394", "resource": "Reactome", "description": "DNA Damage Recognition in GG-NER" }, { "id": "R-HSA-5696395", "name": "Formation of Incision Complex in GG-NER", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5696395", "resource": "Reactome", "description": "Formation of Incision Complex in GG-NER" } ], "orthologs": [ { "uniprot_canonical_ac": "P32628-1", "protein_name": "UV excision repair protein RAD23", "gene_name": "RAD23", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKSTKTKVTEPPIAPESATTPGRENSTEASPSTDASAAPAATAPEGSQPQEEQTATTERTESASTPGFVVGTERNETIERIMEMGYQREEVERALRAAFNNPDRAVEYLLMGIPENLRQPEPQQQTAAAAEQPSTAATTAEQPAEDDLFAQAAQGGNASSGALGTTGGATDAAQGGPPGSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAVGDNMQDVMEGADDMVEGEDIEVTGEAAAAGLGQGEGEGSFQVDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSDHAD", "length": 398 }, "evidence": [ { "id": "P54727", "url": "https://omabrowser.org/oma/group/P54727/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P54728-1", "protein_name": "UV excision repair protein RAD23 homolog B", "gene_name": "Rad23b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILSDDTALKEYKIDEKNFVVVMVTKPKAVTTAVPATTQPSSTPSPTAVSSSPAVAAAQAPAPTPALPPTSTPASTAPASTTASSEPAPAGATQPEKPAEKPAQTPVLTSPAPADSTPGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPPQAVSTGTPQSPAVAAAAATTTATTTTTSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGSQGGGGGGGGGGGGGGGGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED", "length": 416 }, "evidence": [ { "id": "45226627", "url": "http://www.informatics.jax.org/homology/45226627", "database": "MGI" }, { "id": "P54727", "url": "https://omabrowser.org/oma/group/P54727/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q4KMA2-1", "protein_name": "UV excision repair protein RAD23 homolog B", "gene_name": "Rad23b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILSDDTALKEYKIDEKNFVVVMVTKPKAVTSAVPATTQQSSSPSTTTVSSSPAAAVAQAPAPTPALAPTSTPASTTPASTTASSEPAPTGATQPEKPAEKPAQTPVLTSPAPADSTPGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPPQAVSTGTPQSPAVAAAAATTTATTTTTSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGGGGGGGGGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED", "length": 415 }, "evidence": [ { "id": "45226627", "url": "http://www.informatics.jax.org/homology/45226627", "database": "MGI" }, { "id": "P54727", "url": "https://omabrowser.org/oma/group/P54727/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "proteasome complex", "id": "GO:0000502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000502", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "XPC complex", "id": "GO:0071942", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071942", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "regulation of proteasomal ubiquitin-dependent protein catabolic process", "id": "GO:0032434", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032434", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "nucleotide-excision repair", "id": "GO:0006289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006289", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "cellular response to interleukin-7", "id": "GO:0098761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098761", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "polyubiquitin modification-dependent protein binding", "id": "GO:0031593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031593", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "damaged DNA binding", "id": "GO:0003684", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003684", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "ubiquitin binding", "id": "GO:0043130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043130", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "proteasome binding", "id": "GO:0070628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070628", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "single-stranded DNA binding", "id": "GO:0003697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" }, { "name": "DNA damage sensor activity", "id": "GO:0140612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140612", "evidence": [ { "database": "UniProtKB", "id": "P54727", "url": "https://www.uniprot.org/uniprot/P54727" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 29 }, { "field": "total_sites", "count": 27 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 27 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 29 }, { "field": "total_sites", "count": 27 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 27 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 29 }, { "field": "total_sites", "count": 20 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 26 }, { "field": "total_sites", "count": 20 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 128 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }