{ "uniprot_canonical_ac": "P53961-1", "uniprot_ac": "P53961", "uniprot_id": "GPI15_YEAST", "mass": { "chemical_mass": 26817.0, "monoisotopic_mass": 26817.0 }, "refseq": { "ac": "NP_014360", "name": "phosphatidylinositol N-acetylglucosaminyltransferase GPI15", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014360" }, "gene_names": [ { "name": "GPI15", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P53961", "id": "P53961" }, { "name": "GPI15", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014360", "id": "NP_014360" }, { "name": "N2687", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P53961", "id": "P53961" } ], "protein_names": [ { "name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI15", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P53961" }, { "name": "2.4.1.198", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53961" }, { "name": "GPI-GlcNAc transferase complex subunit GPI5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53961" }, { "name": "GPI-GnT subunit GPI5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53961" }, { "name": "PIGH homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53961" }, { "name": "phosphatidylinositol N-acetylglucosaminyltransferase GPI15", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014360", "id": "NP_014360" } ], "function": [ { "annotation": "Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961#function" }, { "database": "PubMed", "id": "11746600", "url": "https://glygen.org/publication/PubMed/11746600" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "common_name": "Yeast" } ], "gene": [ { "name": "GPI15", "url": "https://www.uniprot.org/uniprot/P53961", "locus": {} } ], "crossref": [ { "id": "855690", "url": "https://www.ncbi.nlm.nih.gov/gene/855690", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P53961", "url": "https://www.ebi.ac.uk/intact/interactors/id:P53961*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR019328", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019328", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044215", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044215", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YNL038W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL038W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NASAFWI", "url": "https://omabrowser.org/oma/group/NASAFWI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2014706at2759", "url": "http://www.orthodb.org/?query=2014706at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15231", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15231", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15231:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15231:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10181", "url": "http://pfam.xfam.org/family/PF10181", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P53961", "url": "http://purl.obolibrary.org/obo/PR_P53961", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014360", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004983", "url": "https://www.yeastgenome.org/locus/S000004983", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53961-1", "url": "https://www.uniprot.org/uniprot/P53961-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MISKEYEFGKTSILNRKKYTLVIDEDKNGNFIRFTVLPVSNRKFKKVKQNGRVEINMGIQYHQIVLILLLNILFYVICLRSRFLEHINRTFEVTIARSFQILIIMGLFALGTIILVRGPSVETVTIFKESGLQLSRVKGMVIFPQQWNRKFFEQVEFISNERIIDVVINEGFCRGFRVIFYLAAIVRKSSTLKLLFPSNLPSIDDQRLIYNISRKYLSKQEKPLSRPKD", "length": 229, "header": "sp|P53961-1|GPI15_YEAST Isoform 1 of Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI15 OS=Saccharomyces cerevisiae S288C OX=559292 GN=GPI15 PE=3 SV=2 CANONICAL=P53961-1" }, "isoforms": [ { "isoform_ac": "P53961-1", "url": "", "sequence": { "sequence": "MISKEYEFGKTSILNRKKYTLVIDEDKNGNFIRFTVLPVSNRKFKKVKQNGRVEINMGIQYHQIVLILLLNILFYVICLRSRFLEHINRTFEVTIARSFQILIIMGLFALGTIILVRGPSVETVTIFKESGLQLSRVKGMVIFPQQWNRKFFEQVEFISNERIIDVVINEGFCRGFRVIFYLAAIVRKSSTLKLLFPSNLPSIDDQRLIYNISRKYLSKQEKPLSRPKD", "length": 229, "header": "sp|P53961-1|GPI15_YEAST Isoform 1 of Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI15 OS=Saccharomyces cerevisiae S288C OX=559292 GN=GPI15 PE=3 SV=2 CANONICAL=P53961-1" }, "locus": { "chromosome": "XIV", "start_pos": 557780, "end_pos": 557020, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YNL038W_mRNA", "url": "https://www.ensembl.org/id/YNL038W_mRNA" }, { "database": "Ensembl Peptide", "id": "YNL038W", "url": "https://www.ensembl.org/id/YNL038W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity" ], "publication": [ { "title": "Ynl038wp (Gpi15p) is the Saccharomyces cerevisiae homologue of human Pig-Hp and participates in the first step in glycosylphosphatidylinositol assembly.", "journal": "Yeast", "date": "2001", "authors": "Orlean P., Yan B.C., Westfall B.A.", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "reference": [ { "type": "PubMed", "id": "11746600", "url": "https://glygen.org/publication/PubMed/11746600" } ] }, { "title": "Finding functional features in Saccharomyces genomes by phylogenetic footprinting.", "journal": "Science", "date": "2003", "authors": "Fulton L., Waterston R., Fulton B., Johnston M., Cohen B.A., Cliften P.F., Desikan A., Majors J., Sudarsanam P.", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "reference": [ { "type": "PubMed", "id": "12775844", "url": "https://glygen.org/publication/PubMed/12775844" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.", "journal": "Nature", "date": "1997", "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "reference": [ { "type": "PubMed", "id": "9169873", "url": "https://glygen.org/publication/PubMed/9169873" } ] } ], "pathway": [ { "id": "sce:YNL038W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL038W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex", "id": "GO:0000506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000506", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "GPI anchor biosynthetic process", "id": "GO:0006506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006506", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "pmid": "" }, { "name": "fungal-type cell wall organization", "id": "GO:0031505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031505", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "phosphatidylinositol N-acetylglucosaminyltransferase activity", "id": "GO:0017176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017176", "evidence": [ { "database": "UniProtKB", "id": "P53961", "url": "https://www.uniprot.org/uniprot/P53961" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 211, "end_pos": 213, "annotation": "n_glycosylation_sequon" }, { "start_pos": 88, "end_pos": 90, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14789", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + UDP-N-acetyl-alpha-D-glucosamine = a 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P37287-1", "Q64323-1", "P32363-1", "Q04082-1", "P46961-1", "P53306-1", "P53961-1", "Q54M40-1" ], "evidence": [ { "id": "14789", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14789" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P32363", "gene_name": "SPT14", "activity": [ { "ec_number": "2.4.1.198", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + UDP-N-acetyl-alpha-D-glucosamine = a 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H(+) + UDP.", "evidence": [ { "id": "P32363", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32363" } ] }, { "ec_number": "2.4.1.198", "activity": "", "evidence": [ { "id": "P32363", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32363" } ] } ] }, { "uniprot_ac": "P37287", "gene_name": "PIGA", "activity": [ { "ec_number": "2.4.1.198", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + UDP-N-acetyl-alpha-D-glucosamine = a 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H(+) + UDP.", "evidence": [ { "id": "P37287", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P37287" } ] }, { "ec_number": "2.4.1.198", "activity": "", "evidence": [ { "id": "P37287", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P37287" } ] } ] }, { "uniprot_ac": "P46961", "gene_name": "GPI2", "activity": [ { "ec_number": "2.4.1.198", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + UDP-N-acetyl-alpha-D-glucosamine = a 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H(+) + UDP.", "evidence": [ { "id": "P46961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46961" } ] }, { "ec_number": "2.4.1.198", "activity": "", "evidence": [ { "id": "P46961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46961" } ] } ] }, { "uniprot_ac": "P53306", "gene_name": "GPI1", "activity": [ { "ec_number": "2.4.1.198", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + UDP-N-acetyl-alpha-D-glucosamine = a 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H(+) + UDP.", "evidence": [ { "id": "P53306", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53306" } ] }, { "ec_number": "2.4.1.198", "activity": "", "evidence": [ { "id": "P53306", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53306" } ] } ] }, { "uniprot_ac": "P53961", "gene_name": "GPI15", "activity": [ { "ec_number": "2.4.1.198", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + UDP-N-acetyl-alpha-D-glucosamine = a 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H(+) + UDP.", "evidence": [ { "id": "P53961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53961" } ] }, { "ec_number": "2.4.1.198", "activity": "", "evidence": [ { "id": "P53961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53961" } ] } ] }, { "uniprot_ac": "Q04082", "gene_name": "GPI19", "activity": [ { "ec_number": "2.4.1.198", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + UDP-N-acetyl-alpha-D-glucosamine = a 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H(+) + UDP.", "evidence": [ { "id": "Q04082", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04082" } ] }, { "ec_number": "2.4.1.198", "activity": "", "evidence": [ { "id": "Q04082", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04082" } ] } ] }, { "uniprot_ac": "Q54M40", "gene_name": "pigC", "activity": [ { "ec_number": "2.4.1.198", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + UDP-N-acetyl-alpha-D-glucosamine = a 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H(+) + UDP.", "evidence": [ { "id": "Q54M40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54M40" } ] }, { "ec_number": "2.4.1.198", "activity": "", "evidence": [ { "id": "Q54M40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54M40" } ] } ] }, { "uniprot_ac": "Q64323", "gene_name": "Piga", "activity": [ { "ec_number": "2.4.1.198", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + UDP-N-acetyl-alpha-D-glucosamine = a 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H(+) + UDP.", "evidence": [ { "id": "Q64323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64323" } ] }, { "ec_number": "2.4.1.198", "activity": "", "evidence": [ { "id": "Q64323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64323" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }