{ "uniprot_canonical_ac": "P53892-1", "uniprot_ac": "P53892", "uniprot_id": "IBD2_YEAST", "mass": { "chemical_mass": 40016.0, "monoisotopic_mass": 40016.0 }, "refseq": { "ac": "NP_014235", "name": "Ibd2p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014235" }, "gene_names": [ { "name": "IBD2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P53892", "id": "P53892" }, { "name": "IBD2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014235", "id": "NP_014235" }, { "name": "N1714", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P53892", "id": "P53892" } ], "protein_names": [ { "name": "Protein IBD2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P53892" }, { "name": "Ibd2p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014235", "id": "NP_014235" }, { "name": "Inhibition of bud division protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53892" } ], "function": [ { "annotation": "Part of a checkpoint which monitors spindle integrity and prevents premature exit from mitosis. This cell-cycle arrest depends upon inhibition of the G-protein TEM1 by the BFA1/BUB2 complex.", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892#function" }, { "database": "PubMed", "id": "12072457", "url": "https://glygen.org/publication/PubMed/12072457" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" } ], "common_name": "Yeast" } ], "gene": [ { "name": "IBD2", "url": "https://www.uniprot.org/uniprot/P53892", "locus": {} } ], "crossref": [ { "id": "855557", "url": "https://www.ncbi.nlm.nih.gov/gene/855557", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P53892", "url": "https://www.ebi.ac.uk/intact/interactors/id:P53892*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR026231", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026231", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YNL164C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL164C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PKNMIKW", "url": "https://omabrowser.org/oma/group/PKNMIKW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2036412at2759", "url": "http://www.orthodb.org/?query=2036412at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_P53892", "url": "http://purl.obolibrary.org/obo/PR_P53892", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014235", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014235", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005108", "url": "https://www.yeastgenome.org/locus/S000005108", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53892-1", "url": "https://www.uniprot.org/uniprot/P53892-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTPTNQSSGTTNASVEVLSEDGPMPINVMMQEGVKALTKILSNQLQDRQAFQNAPHAMQFVIRNGGKALSNARLEELKDALPKMDSLSLEDELAKIDGQSAYHIDSAEEKETFESKIGQIASRNSADFIIEEDLQNILDDDLKDSELNLDGEEAEIIFDYESQELDTPDGIGEKISQMIESVLPGGFGSEEQGGLRTVTNVEDLDVAEEVTDIDHDTVDAARLHGDGQHSISSRKHSRSKNSKKNGHVRRHDFYDESRDHKSCCPHHHYENLSKLRNYYYHDFEYISRTENRVPDFSVLVNESSPMCLFCEYYMVFGEPPRNMIKWYNRTFGYNRMPNPPRDEQDSRKRNR", "length": 351, "header": "sp|P53892-1|IBD2_YEAST Isoform 1 of Protein IBD2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=IBD2 PE=1 SV=1 CANONICAL=P53892-1" }, "isoforms": [ { "isoform_ac": "P53892-1", "url": "", "sequence": { "sequence": "MTPTNQSSGTTNASVEVLSEDGPMPINVMMQEGVKALTKILSNQLQDRQAFQNAPHAMQFVIRNGGKALSNARLEELKDALPKMDSLSLEDELAKIDGQSAYHIDSAEEKETFESKIGQIASRNSADFIIEEDLQNILDDDLKDSELNLDGEEAEIIFDYESQELDTPDGIGEKISQMIESVLPGGFGSEEQGGLRTVTNVEDLDVAEEVTDIDHDTVDAARLHGDGQHSISSRKHSRSKNSKKNGHVRRHDFYDESRDHKSCCPHHHYENLSKLRNYYYHDFEYISRTENRVPDFSVLVNESSPMCLFCEYYMVFGEPPRNMIKWYNRTFGYNRMPNPPRDEQDSRKRNR", "length": 351, "header": "sp|P53892-1|IBD2_YEAST Isoform 1 of Protein IBD2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=IBD2 PE=1 SV=1 CANONICAL=P53892-1" }, "locus": { "chromosome": "XIV", "start_pos": 326320, "end_pos": 325268, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YNL164C_mRNA", "url": "https://www.ensembl.org/id/YNL164C_mRNA" }, { "database": "Ensembl Peptide", "id": "YNL164C", "url": "https://www.ensembl.org/id/YNL164C" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 100, "end_pos": 100, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" }, { "database": "SGD", "id": "P53892", "url": "https://www.yeastgenome.org/locus/P53892" } ], "site_lbl": "Ser100" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "SGD", "id": "P53892", "url": "https://www.yeastgenome.org/locus/P53892" }, { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Tyr102" }, { "start_pos": 106, "end_pos": 106, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P53892", "url": "https://www.yeastgenome.org/locus/P53892" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser106" }, { "start_pos": 115, "end_pos": 115, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P53892", "url": "https://www.yeastgenome.org/locus/P53892" } ], "site_lbl": "Ser115" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" }, { "database": "SGD", "id": "P53892", "url": "https://www.yeastgenome.org/locus/P53892" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Thr211" }, { "start_pos": 230, "end_pos": 230, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P53892", "url": "https://www.yeastgenome.org/locus/P53892" } ], "site_lbl": "Ser230" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P53892", "url": "https://www.yeastgenome.org/locus/P53892" }, { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Ser42" } ], "glycation": [], "keywords": [], "publication": [ { "title": "IBD2 encodes a novel component of the Bub2p-dependent spindle checkpoint in the budding yeast Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2002", "authors": "Song K., Hwang H.-S.", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" } ], "reference": [ { "type": "PubMed", "id": "12072457", "url": "https://glygen.org/publication/PubMed/12072457" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "Journal of proteome research", "date": "2007-03", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" }, { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Mol. Cell. Proteomics", "date": "2008", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" }, { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" }, { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P53892", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53892" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The sequence of 36.8 kb from the left arm of chromosome XIV reveals 24 complete open reading frames: 18 correspond to new genes, one of which encodes a protein similar to the human myotonic dystrophy kinase.", "journal": "Yeast", "date": "1996", "authors": "Nasr F., Becam A.-M., Herbert C.J.", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" } ], "reference": [ { "type": "PubMed", "id": "8686380", "url": "https://glygen.org/publication/PubMed/8686380" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.", "journal": "Nature", "date": "1997", "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" } ], "reference": [ { "type": "PubMed", "id": "9169873", "url": "https://glygen.org/publication/PubMed/9169873" } ] } ], "pathway": [ { "id": "sce:YNL164C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL164C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "spindle pole", "id": "GO:0000922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000922", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" } ], "pmid": "" }, { "name": "mitotic spindle assembly checkpoint signaling", "id": "GO:0007094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007094", "evidence": [ { "database": "UniProtKB", "id": "P53892", "url": "https://www.uniprot.org/uniprot/P53892" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 12, "end_pos": 14, "annotation": "n_glycosylation_sequon" }, { "start_pos": 271, "end_pos": 273, "annotation": "n_glycosylation_sequon" }, { "start_pos": 301, "end_pos": 303, "annotation": "n_glycosylation_sequon" }, { "start_pos": 328, "end_pos": 330, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }