{ "uniprot_canonical_ac": "P53889-1", "uniprot_ac": "P53889", "uniprot_id": "FMP41_YEAST", "mass": { "chemical_mass": 28792.0, "monoisotopic_mass": 28792.0 }, "refseq": { "ac": "NP_014231", "name": "Fmp41p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014231" }, "gene_names": [ { "name": "FMP41", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P53889", "id": "P53889" }, { "name": "FMP41", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014231", "id": "NP_014231" }, { "name": "N1696", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P53889", "id": "P53889" } ], "protein_names": [ { "name": "Uncharacterized mitochondrial hydrolase FMP41", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P53889" }, { "name": "3.-.-.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53889" }, { "name": "Fmp41p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014231", "id": "NP_014231" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "common_name": "Yeast" } ], "gene": [ { "name": "FMP41", "url": "https://www.uniprot.org/uniprot/P53889", "locus": {} } ], "crossref": [ { "id": "855553", "url": "https://www.ncbi.nlm.nih.gov/gene/855553", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P53889", "url": "https://www.ebi.ac.uk/intact/interactors/id:P53889*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR011234", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011234", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036663", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036663", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YNL168C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL168C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NCRKVIC", "url": "https://omabrowser.org/oma/group/NCRKVIC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "9433at2759", "url": "http://www.orthodb.org/?query=9433at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11820", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11820", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11820:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11820:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1NKQ", "url": "https://www.rcsb.org/structure/1NKQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01557", "url": "http://pfam.xfam.org/family/PF01557", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P53889", "url": "http://purl.obolibrary.org/obo/PR_P53889", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014231", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014231", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005112", "url": "https://www.yeastgenome.org/locus/S000005112", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53889-1", "url": "https://www.uniprot.org/uniprot/P53889-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSYNYLKAARKIICIGRNYAAHIKELNNSTPKQPFFFLKPTSSIVTPLSSSLVKTTRPANSTFNGLNEDGTNPGPIFIPRGVKVHHEIELALIVSKHLSNVTKMKPEEVYDSISGVALALDLTARNVQDEAKKKGLPWTISKGFDTFMPISAIVSREKFSSYKSNLQDIFRVKCSVNGQLRQDGGTNLMLHPLHKILQHISTMISLEPGDIILTGTPAGVGELKPGDRVHCELLQNNDNIVDMNFECENRPGPYEFRET", "length": 259, "header": "sp|P53889-1|FMP41_YEAST Isoform 1 of Uncharacterized mitochondrial hydrolase FMP41 OS=Saccharomyces cerevisiae S288C OX=559292 GN=FMP41 PE=1 SV=1 CANONICAL=P53889-1" }, "isoforms": [ { "isoform_ac": "P53889-1", "url": "", "sequence": { "sequence": "MSYNYLKAARKIICIGRNYAAHIKELNNSTPKQPFFFLKPTSSIVTPLSSSLVKTTRPANSTFNGLNEDGTNPGPIFIPRGVKVHHEIELALIVSKHLSNVTKMKPEEVYDSISGVALALDLTARNVQDEAKKKGLPWTISKGFDTFMPISAIVSREKFSSYKSNLQDIFRVKCSVNGQLRQDGGTNLMLHPLHKILQHISTMISLEPGDIILTGTPAGVGELKPGDRVHCELLQNNDNIVDMNFECENRPGPYEFRET", "length": 259, "header": "sp|P53889-1|FMP41_YEAST Isoform 1 of Uncharacterized mitochondrial hydrolase FMP41 OS=Saccharomyces cerevisiae S288C OX=559292 GN=FMP41 PE=1 SV=1 CANONICAL=P53889-1" }, "locus": { "chromosome": "XIV", "start_pos": 318809, "end_pos": 318033, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YNL168C_mRNA", "url": "https://www.ensembl.org/id/YNL168C_mRNA" }, { "database": "Ensembl Peptide", "id": "YNL168C", "url": "https://www.ensembl.org/id/YNL168C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The proteome of Saccharomyces cerevisiae mitochondria.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2003", "authors": "Sickmann A., Zahedi R.P., Rehling P., Chacinska A., Guiard B., Meyer H.E., Meisinger C., Reinders J., Pfanner N., Joppich C., Perschil I., Schoenfisch B., Wagner Y.", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "reference": [ { "type": "PubMed", "id": "14576278", "url": "https://glygen.org/publication/PubMed/14576278" } ] }, { "title": "Yeast translational response to high salinity: global analysis reveals regulation at multiple levels.", "journal": "RNA", "date": "2008", "authors": "Melamed D., Arava Y., Pnueli L.", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "reference": [ { "type": "PubMed", "id": "18495938", "url": "https://glygen.org/publication/PubMed/18495938" } ] }, { "title": "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "reference": [ { "type": "PubMed", "id": "22814378", "url": "https://glygen.org/publication/PubMed/22814378" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The sequence of 36.8 kb from the left arm of chromosome XIV reveals 24 complete open reading frames: 18 correspond to new genes, one of which encodes a protein similar to the human myotonic dystrophy kinase.", "journal": "Yeast", "date": "1996", "authors": "Nasr F., Becam A.-M., Herbert C.J.", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "reference": [ { "type": "PubMed", "id": "8686380", "url": "https://glygen.org/publication/PubMed/8686380" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.", "journal": "Nature", "date": "1997", "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "reference": [ { "type": "PubMed", "id": "9169873", "url": "https://glygen.org/publication/PubMed/9169873" } ] } ], "pathway": [ { "id": "sce:YNL168C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL168C", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6AYQ8-1", "protein_name": "Acylpyruvase FAHD1, mitochondrial", "gene_name": "Fahd1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASTKPLSRFWEWGKNIVCVGRNYADHVKEMRSTVLSEPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLLGRRGEAVPEAAAMDYVAGYALCLDMTARDVQDECKKKGLPWTLAKSFTSSCPVSAFVPKEKIPDPHALRLWLKVNGELRQEGKTSSMIFSIPYIISYVSKIITLEEGDLILTGTPKGVGAVKENDEIEAGIDGVVSMRFKVERSKY", "length": 221 }, "evidence": [ { "id": "P53889", "url": "https://omabrowser.org/oma/group/P53889/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8R0F8-1", "protein_name": "Acylpyruvase FAHD1, mitochondrial", "gene_name": "Fahd1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTQSCTMASTKPLSRFWEWGKNIVCVGRNYADHVKEMRSTVLSEPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLLGKRGEAIPEAAAMDYVAGYALCLDMTARDVQEECKKKGLPWTLAKSFTSSCPVSAFVPKEKIPDPHALRLWLKVNGELRQEGKTSSMIFSIPYIISYVSKIITLEEGDLILTGTPKGVGPIKENDEIEAGIDGVVSMRFKVKRSEY", "length": 227 }, "evidence": [ { "id": "P53889", "url": "https://omabrowser.org/oma/group/P53889/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "acetylpyruvate hydrolase activity", "id": "GO:0018773", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018773", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P53889", "url": "https://www.uniprot.org/uniprot/P53889" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 100, "end_pos": 102, "annotation": "n_glycosylation_sequon" }, { "start_pos": 27, "end_pos": 29, "annotation": "n_glycosylation_sequon" }, { "start_pos": 28, "end_pos": 30, "annotation": "n_glycosylation_sequon" }, { "start_pos": 60, "end_pos": 62, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-SCE-9012016", "name": "FAHD1:Zn2+ dimer hydrolyses OA to PYR", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial matrix", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P53889-1" ], "evidence": [ { "id": "R-SCE-9012016", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-9012016" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P53889", "gene_name": "FMP41", "activity": [ { "ec_number": "3.-.-.-", "activity": "", "evidence": [ { "id": "P53889", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53889" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }