{ "uniprot_canonical_ac": "P53852-1", "uniprot_ac": "P53852", "uniprot_id": "SYC_YEAST", "mass": { "chemical_mass": 87530.0, "monoisotopic_mass": 87530.0 }, "refseq": { "ac": "NP_014152", "name": "cysteine--tRNA ligase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014152" }, "gene_names": [ { "name": "CRS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014152", "id": "NP_014152" }, { "name": "N0885", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P53852", "id": "P53852" } ], "protein_names": [ { "name": "Cysteine--tRNA ligase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P53852" }, { "name": "6.1.1.16", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53852" }, { "name": "CysRS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53852" }, { "name": "Cysteinyl-tRNA synthetase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53852" }, { "name": "cysteine--tRNA ligase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014152", "id": "NP_014152" } ], "function": [], "disease": [ { "disease_id": "DOID:10907", "recommended_name": { "id": "DOID:10907", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10907", "name": "microcephaly", "description": "A congenital nervous system abnormality that is characterized by a significantly smaller than normal head in infants." }, "synonyms": [ { "id": "DOID:10907", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10907", "name": "Microcephalus", "description": "" }, { "id": "DOID:10907", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10907", "name": "microencephaly", "description": "" } ], "evidence": [ { "id": "10907", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10907" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/P53852", "locus": {} } ], "crossref": [ { "id": "cd00672", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00672", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "855474", "url": "https://www.ncbi.nlm.nih.gov/gene/855474", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P53852", "url": "https://www.ebi.ac.uk/intact/interactors/id:P53852*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR009080", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009080", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014729", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014729", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015803", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015803", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024909", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024909", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032678", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032678", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YNL247W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL247W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FHNDMKS", "url": "https://omabrowser.org/oma/group/FHNDMKS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2140072at2759", "url": "http://www.orthodb.org/?query=2140072at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10890", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10890", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10890:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10890:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01406", "url": "http://pfam.xfam.org/family/PF01406", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P53852", "url": "http://purl.obolibrary.org/obo/PR_P53852", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014152", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014152", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005191", "url": "https://www.yeastgenome.org/locus/S000005191", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53852-1", "url": "https://www.uniprot.org/uniprot/P53852-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNIFIKALRRYTIMSTPKIVQPKWKVPTPQAKETVLKLYNSLTRSKVEFIPQSGNRGVTWYSCGPTVYDASHMGHARNYVSIDINRRIIQDYFGYDVQFVQNVTDIDDKIILRARQNYLFDNFVKENDTKFNATVVDKVKTALFQYINKNFTIQGSEIKTIEEFETWLSNADTETLKLENPKFPMHVTAVQNAIESITKGDSMDAEVAFEKVKDVTVPLLDKELGSTISNPEIFRQLPAYWEQKFNDDMLSLNVLPPTVTTRVSEYVPEIIDFVQKIIDNGYAYATSDGSVYFDTLKFDKSPNHDYAKCQPWNKGQLDLINDGEGSLSNFADNGKKSNNDFALWKASKAGEPEWESPWGKGRPGWHIECSVMASDILGSNIDIHSGGIDLAFPHHDNELAQSEARFDNQQWINYFLHTGHLHIEGQKMSKSLKNFITIQEALKKFSPRQLRLAFASVQWNNQLDFKESLIHEVKSFENSMNNFFKTIRALKNDAASAGHISKKFSPLEKELLADFVESESKVHSAFCDNLSTPVALKTLSELVTKSNTYITTAGAALKIEPLIAICSYITKILRIIGFPSRPDNLGWAAQAGSNDGSLGSLEDTVMPYVKCLSTFRDDVRSLAIKKAEPKEFLQLTDKIRNEDLLNLNVALDDRNGQSALIKFLTNDEKLEIVKLNEEKHANELAKKQKKLEQQKLREQKENERKQKAQIKPQDMFKDVTLYSAWDEQGLPTKDKDGNDITKSMTKKLKKQWEQQKKLHEEYFGEDK", "length": 767, "header": "sp|P53852-1|SYC_YEAST Isoform 1 of Cysteine--tRNA ligase OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=P53852-1" }, "isoforms": [ { "isoform_ac": "P53852-1", "url": "", "sequence": { "sequence": "MNIFIKALRRYTIMSTPKIVQPKWKVPTPQAKETVLKLYNSLTRSKVEFIPQSGNRGVTWYSCGPTVYDASHMGHARNYVSIDINRRIIQDYFGYDVQFVQNVTDIDDKIILRARQNYLFDNFVKENDTKFNATVVDKVKTALFQYINKNFTIQGSEIKTIEEFETWLSNADTETLKLENPKFPMHVTAVQNAIESITKGDSMDAEVAFEKVKDVTVPLLDKELGSTISNPEIFRQLPAYWEQKFNDDMLSLNVLPPTVTTRVSEYVPEIIDFVQKIIDNGYAYATSDGSVYFDTLKFDKSPNHDYAKCQPWNKGQLDLINDGEGSLSNFADNGKKSNNDFALWKASKAGEPEWESPWGKGRPGWHIECSVMASDILGSNIDIHSGGIDLAFPHHDNELAQSEARFDNQQWINYFLHTGHLHIEGQKMSKSLKNFITIQEALKKFSPRQLRLAFASVQWNNQLDFKESLIHEVKSFENSMNNFFKTIRALKNDAASAGHISKKFSPLEKELLADFVESESKVHSAFCDNLSTPVALKTLSELVTKSNTYITTAGAALKIEPLIAICSYITKILRIIGFPSRPDNLGWAAQAGSNDGSLGSLEDTVMPYVKCLSTFRDDVRSLAIKKAEPKEFLQLTDKIRNEDLLNLNVALDDRNGQSALIKFLTNDEKLEIVKLNEEKHANELAKKQKKLEQQKLREQKENERKQKAQIKPQDMFKDVTLYSAWDEQGLPTKDKDGNDITKSMTKKLKKQWEQQKKLHEEYFGEDK", "length": 767, "header": "sp|P53852-1|SYC_YEAST Isoform 1 of Cysteine--tRNA ligase OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=P53852-1" }, "locus": { "chromosome": "XIV", "start_pos": 185175, "end_pos": 182875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YNL247W_mRNA", "url": "https://www.ensembl.org/id/YNL247W_mRNA" }, { "database": "Ensembl Peptide", "id": "YNL247W", "url": "https://www.ensembl.org/id/YNL247W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 326, "end_pos": 326, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" }, { "database": "SGD", "id": "P53852", "url": "https://www.yeastgenome.org/locus/P53852" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser326" }, { "start_pos": 328, "end_pos": 328, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P53852", "url": "https://www.yeastgenome.org/locus/P53852" } ], "site_lbl": "Ser328" }, { "start_pos": 665, "end_pos": 665, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P53852", "url": "https://www.yeastgenome.org/locus/P53852" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr665" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "Journal of proteome research", "date": "2007-03", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" }, { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-06-19", "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" } ], "reference": [ { "type": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" }, { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science", "date": "2009", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" }, { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P53852", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53852" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.", "journal": "Nature", "date": "1997", "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "reference": [ { "type": "PubMed", "id": "9169873", "url": "https://glygen.org/publication/PubMed/9169873" } ] }, { "title": "Sequence analysis of the 33 kb long region between ORC5 and SUI1 from the left arm of chromosome XIV from Saccharomyces cerevisiae.", "journal": "Yeast", "date": "1997", "authors": "Gueldener U., Hegemann J.H., Fiedler T.A., Beinhauer J.D., Sen-Gupta M.", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "reference": [ { "type": "PubMed", "id": "9234673", "url": "https://glygen.org/publication/PubMed/9234673" } ] }, { "title": "Cysteinyl-tRNA synthetase from Saccharomyces cerevisiae. Purification, characterization and assignment to the genomic sequence YNL247w.", "journal": "Biochimie", "date": "1997", "authors": "Le Caer J.-P., Motorin Y., Waller J.-P.", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "reference": [ { "type": "PubMed", "id": "9523015", "url": "https://glygen.org/publication/PubMed/9523015" } ] } ], "pathway": [ { "id": "sce:YNL247W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL247W", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P49589-1", "protein_name": "Cysteine--tRNA ligase, cytoplasmic", "gene_name": "CARS1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVYDASHMGHARSYISFDILRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYVSNGSVYFDTAKFASSEKHSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSAMAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGHLTIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEKFLNEFFLNVKDILRAPVDITGQFEKWGEEEAELNKNFYDKKTAIHKALCDNVDTRTVMEEMRALVSQCNLYMAARKAVRKRPNQALLENIALYLTHMLKIFGAVEEDSSLGFPVGGPGTSLSLEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSDALRDNILPELGVRFEDHEGLPTVVKLVDRNTLLKEREEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ", "length": 748 }, "evidence": [ { "id": "P53852", "url": "https://omabrowser.org/oma/group/P53852/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q7KN90-1", "protein_name": "Cysteine--tRNA ligase, cytoplasmic", "gene_name": "CysRS", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSKRGQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDILRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQDTCAKNTDPDKKIMLDKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKGAQINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAANNSVYFDVNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWWDSPWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTGHLTIAGCKMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFFLNVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAIRELVSVSNVYIRDNKTRLNSLLLRNVATYITDLLHVFGAISGPRGGIGFPVSGGSGAQAAGADLETTVLPYVQSLAEFRYLVREQAKTLKAFDILKLCDDLRDNVLPNLGVRLEDKDIGKYAVKLVDRDSLLREREAKLAAEAEKAAEKERKKQAAAEAAAAKEAQRRVNPKEMFLAETEKYSAFDENGLPTHDKEGKEVSKGQIKKLQKLQQQQEQRYNEYLASIEKA", "length": 741 }, "evidence": [ { "id": "P53852", "url": "https://omabrowser.org/oma/group/P53852/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9ER72-1", "protein_name": "Cysteine--tRNA ligase, cytoplasmic", "gene_name": "Cars1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAGSSAEQAADYRSILSISDEAARVQALDQHLSTRSYIQGYSLSQADVDVFRQLSAPPADSRLFHVARWFRHIEALLGGPQGRDEPCRLQASKGRRVQPQWSPPAGTEPCRLRLYNSLTRNKDVFIPQDGKKVTWYCCGPTVYDASHMGHARSYISFDILRRVLRDYFQYDVFYCMNITDIDDKIIRRARQNYLFEQYREQKPPATQLLKDVRDAMKPFSVKLSETTDPDKRQMLERIQNSVKLATEPLEQAVRSSLSGEEVDSKVQVLLEEAKDLLSDWLDSTGGSEVTDNSIFSKLPKFWEEEFHKDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYASNGSVYFDTAKFAASEKHSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSAMAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGHLTIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEKFMNEFFLNVKDILRAPVDITGQFEKWEAEEVELNKNFYGKKTAVHEALCDNIDTRTVMEEMRALVSQCNLYMAARKAERRRPNRALLENIAMYLTHMLKIFGAIEEESPLGFPVGGPGTNLNLESTVMPYLQVLSEFREGVRKIAREKKVLEVLQLSDALRDDILPELGVRFEDHEGLPTVVKLVDRDTLLKEKEGKKRAEEEKRRKKEEAARKKQEQEAAKLAKMKIPPSEMFLSEVNKYSKFDENGLPTHDTEGKELSKGQAKKLKKLFEAQEKLYKEYLQMLQNGSLQ", "length": 831 }, "evidence": [ { "id": "P53852", "url": "https://omabrowser.org/oma/group/P53852/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "pmid": "" }, { "name": "cysteine-tRNA ligase activity", "id": "GO:0004817", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004817", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "cysteinyl-tRNA aminoacylation", "id": "GO:0006423", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006423", "evidence": [ { "database": "UniProtKB", "id": "P53852", "url": "https://www.uniprot.org/uniprot/P53852" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 102, "end_pos": 104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 127, "end_pos": 129, "annotation": "n_glycosylation_sequon" }, { "start_pos": 132, "end_pos": 134, "annotation": "n_glycosylation_sequon" }, { "start_pos": 150, "end_pos": 152, "annotation": "n_glycosylation_sequon" }, { "start_pos": 529, "end_pos": 531, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17773", "name": "", "equation": "ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P49589-1", "Q9HA77-1", "Q8BYM8-1", "Q9ER72-1", "P53852-1", "Q54KR1-1", "Q54ZY3-1", "Q7KN90-1" ], "evidence": [ { "id": "17773", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17773" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P49589", "gene_name": "CARS1", "activity": [ { "ec_number": "6.1.1.16", "activity": "ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys).", "evidence": [ { "id": "P49589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49589" } ] }, { "ec_number": "6.1.1.16", "activity": "", "evidence": [ { "id": "P49589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49589" } ] } ] }, { "uniprot_ac": "P53852", "gene_name": "", "activity": [ { "ec_number": "6.1.1.16", "activity": "ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys).", "evidence": [ { "id": "P53852", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53852" } ] }, { "ec_number": "6.1.1.16", "activity": "", "evidence": [ { "id": "P53852", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53852" } ] } ] }, { "uniprot_ac": "Q54KR1", "gene_name": "cysS", "activity": [ { "ec_number": "6.1.1.16", "activity": "ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys).", "evidence": [ { "id": "Q54KR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54KR1" } ] }, { "ec_number": "6.1.1.16", "activity": "", "evidence": [ { "id": "Q54KR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54KR1" } ] } ] }, { "uniprot_ac": "Q54ZY3", "gene_name": "mcysS", "activity": [ { "ec_number": "6.1.1.16", "activity": "ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys).", "evidence": [ { "id": "Q54ZY3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ZY3" } ] }, { "ec_number": "6.1.1.16", "activity": "", "evidence": [ { "id": "Q54ZY3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ZY3" } ] } ] }, { "uniprot_ac": "Q7KN90", "gene_name": "CysRS", "activity": [ { "ec_number": "6.1.1.16", "activity": "ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys).", "evidence": [ { "id": "Q7KN90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KN90" } ] }, { "ec_number": "6.1.1.16", "activity": "", "evidence": [ { "id": "Q7KN90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KN90" } ] } ] }, { "uniprot_ac": "Q8BYM8", "gene_name": "Cars2", "activity": [ { "ec_number": "6.1.1.16", "activity": "ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys).", "evidence": [ { "id": "Q8BYM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYM8" } ] }, { "ec_number": "6.1.1.16", "activity": "", "evidence": [ { "id": "Q8BYM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYM8" } ] } ] }, { "uniprot_ac": "Q9ER72", "gene_name": "Cars1", "activity": [ { "ec_number": "6.1.1.16", "activity": "ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys).", "evidence": [ { "id": "Q9ER72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ER72" } ] }, { "ec_number": "6.1.1.16", "activity": "", "evidence": [ { "id": "Q9ER72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ER72" } ] } ] }, { "uniprot_ac": "Q9HA77", "gene_name": "CARS2", "activity": [ { "ec_number": "6.1.1.16", "activity": "ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys).", "evidence": [ { "id": "Q9HA77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HA77" } ] }, { "ec_number": "6.1.1.16", "activity": "", "evidence": [ { "id": "Q9HA77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HA77" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }