{ "uniprot_canonical_ac": "P53849-1", "uniprot_ac": "P53849", "uniprot_id": "GIS2_YEAST", "mass": { "chemical_mass": 17103.0, "monoisotopic_mass": 17103.0 }, "refseq": { "ac": "NP_014144", "name": "mRNA-binding translational activator GIS2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014144" }, "gene_names": [ { "name": "GIS2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P53849", "id": "P53849" }, { "name": "GIS2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014144", "id": "NP_014144" }, { "name": "N0852", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P53849", "id": "P53849" } ], "protein_names": [ { "name": "Zinc finger protein GIS2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P53849" }, { "name": "mRNA-binding translational activator GIS2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014144", "id": "NP_014144" } ], "function": [ { "annotation": "May act in the sexual differentiation pathway.", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849#function" }, { "database": "PubMed", "id": "10628841", "url": "https://glygen.org/publication/PubMed/10628841" } ] } ], "disease": [ { "disease_id": "DOID:0050759", "recommended_name": { "id": "DOID:0050759", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050759", "name": "myotonic dystrophy type 2", "description": "A myotonic disease that is characterized by myotonia and progressive, proximal muscle wasting and weakness affecting the skeletal and smooth muscles of the neck, shoulders, elbows and hips and has_material_basis_in the autosomal dominant inheritance of the CNBP (ZNF9) gene containing an expansion of a CCTG repeat in intron one." }, "synonyms": [ { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "myotonic dystrophy type 2", "description": "Myotonic dystrophy type 2 (MD2), also known as proximal myotonic myopathy, is a very rare genetic multi-system disorder of late childhood or adult-onset characterized by mild myotonia, muscle weakness, and rarely cardiac conduction disorders." }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "CNBP myotonic dystrophy", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "myotonic dystrophy caused by mutation in CNBP", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "myotonic dystrophy type 2", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "proximal myotonic dystrophy", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "proximal myotonic myopathy", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "ricker disease", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "ricker syndrome", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "DM2", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "PROMM", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "dystrophia myotonica 2", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "dystrophia myotonica type 2", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "myotonic dystrophy 2", "description": "" }, { "id": "MONDO:0011266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011266", "name": "myotonic myopathy, proximal", "description": "" }, { "id": "MIM:602668", "resource": "MIM", "url": "https://www.omim.org/entry/602668", "name": "Dystrophia myotonica 2", "description": "Dystrophia myotonica 2" } ], "evidence": [ { "id": "0050759", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050759" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "common_name": "Yeast" } ], "gene": [ { "name": "GIS2", "url": "https://www.uniprot.org/uniprot/P53849", "locus": {} } ], "crossref": [ { "id": "855466", "url": "https://www.ncbi.nlm.nih.gov/gene/855466", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P53849", "url": "https://www.ebi.ac.uk/intact/interactors/id:P53849*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001878", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001878", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036875", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036875", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YNL255C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL255C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "DCTQVKC", "url": "https://omabrowser.org/oma/group/DCTQVKC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "26554at2759", "url": "http://www.orthodb.org/?query=26554at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23002", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23002", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23002:SF117", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23002:SF117", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00098", "url": "http://pfam.xfam.org/family/PF00098", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P53849", "url": "http://purl.obolibrary.org/obo/PR_P53849", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014144", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014144", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005199", "url": "https://www.yeastgenome.org/locus/S000005199", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53849-1", "url": "https://www.uniprot.org/uniprot/P53849-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSQKACYVCGKIGHLAEDCDSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQRCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQAGHMSRDCQNDRLCYNCNETGHISKDCPKA", "length": 153, "header": "sp|P53849-1|GIS2_YEAST Isoform 1 of Zinc finger protein GIS2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=GIS2 PE=1 SV=1 CANONICAL=P53849-1" }, "isoforms": [ { "isoform_ac": "P53849-1", "url": "", "sequence": { "sequence": "MSQKACYVCGKIGHLAEDCDSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQRCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQAGHMSRDCQNDRLCYNCNETGHISKDCPKA", "length": 153, "header": "sp|P53849-1|GIS2_YEAST Isoform 1 of Zinc finger protein GIS2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=GIS2 PE=1 SV=1 CANONICAL=P53849-1" }, "locus": { "chromosome": "XIV", "start_pos": 167790, "end_pos": 167332, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YNL255C_mRNA", "url": "https://www.ensembl.org/id/YNL255C_mRNA" }, { "database": "Ensembl Peptide", "id": "YNL255C", "url": "https://www.ensembl.org/id/YNL255C" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 114, "end_pos": 114, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P53849", "url": "https://www.yeastgenome.org/locus/P53849" }, { "database": "iPTMnet", "id": "P53849", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53849" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser114" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P53849", "url": "https://www.yeastgenome.org/locus/P53849" }, { "database": "iPTMnet", "id": "P53849", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53849" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr73" }, { "start_pos": 93, "end_pos": 93, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P53849", "url": "https://www.yeastgenome.org/locus/P53849" }, { "database": "iPTMnet", "id": "P53849", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53849" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser93" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Yeast genes GIS1-4: multicopy suppressors of the Gal- phenotype of snf1 mig1 srb8/10/11 cells.", "journal": "Mol. Gen. Genet.", "date": "1999", "authors": "Ronne H., Balciunas D.", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "reference": [ { "type": "PubMed", "id": "10628841", "url": "https://glygen.org/publication/PubMed/10628841" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P53849", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53849" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.", "journal": "Nature", "date": "1997", "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "reference": [ { "type": "PubMed", "id": "9169873", "url": "https://glygen.org/publication/PubMed/9169873" } ] }, { "title": "Sequence analysis of the 33 kb long region between ORC5 and SUI1 from the left arm of chromosome XIV from Saccharomyces cerevisiae.", "journal": "Yeast", "date": "1997", "authors": "Gueldener U., Hegemann J.H., Fiedler T.A., Beinhauer J.D., Sen-Gupta M.", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "reference": [ { "type": "PubMed", "id": "9234673", "url": "https://glygen.org/publication/PubMed/9234673" } ] } ], "pathway": [ { "id": "sce:YNL255C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL255C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "positive regulation of cytoplasmic translation", "id": "GO:2000767", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000767", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "mRNA binding", "id": "GO:0003729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003729", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "pmid": "" }, { "name": "single-stranded RNA binding", "id": "GO:0003727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003727", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "pmid": "" }, { "name": "translation regulator activity", "id": "GO:0045182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045182", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "pmid": "" }, { "name": "single-stranded DNA binding", "id": "GO:0003697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "pmid": "" }, { "name": "P-body", "id": "GO:0000932", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000932", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "pmid": "" }, { "name": "polysomal ribosome", "id": "GO:0042788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042788", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "pmid": "" }, { "name": "cytoplasmic stress granule", "id": "GO:0010494", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010494", "evidence": [ { "database": "UniProtKB", "id": "P53849", "url": "https://www.uniprot.org/uniprot/P53849" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 141, "end_pos": 143, "annotation": "n_glycosylation_sequon" }, { "start_pos": 71, "end_pos": 73, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }