{ "uniprot_canonical_ac": "P53812-1", "uniprot_ac": "P53812", "uniprot_id": "PIPNB_RAT", "mass": { "chemical_mass": 31450.0, "monoisotopic_mass": 31450.0 }, "refseq": { "ac": "NP_446194", "name": "phosphatidylinositol transfer protein beta isoform", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446194" }, "gene_names": [ { "name": "Pitpnb", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P53812", "id": "P53812" }, { "name": "Pitpnb", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446194", "id": "NP_446194" } ], "protein_names": [ { "name": "Phosphatidylinositol transfer protein beta isoform", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P53812" }, { "name": "PI-TP-beta; ptdIns transfer protein beta; ptdInsTP beta; phosphotidylinositol transfer protein, beta", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446194", "id": "NP_446194" }, { "name": "PI-TP-beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53812" }, { "name": "PtdIns transfer protein beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53812" }, { "name": "PtdInsTP beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53812" }, { "name": "phosphatidylinositol transfer protein beta isoform", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446194", "id": "NP_446194" } ], "function": [ { "annotation": "Catalyzes the transfer of phosphatidylinositol between membranes (PubMed:18636990). Also catalyzes the transfer of phosphatidylcholine and sphingomyelin between membranes (By similarity). Required for COPI-mediated retrograde transport from the Golgi to the endoplasmic reticulum; phosphatidylinositol and phosphatidylcholine transfer activity is essential for this function (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812#function" }, { "database": "UniProtKB", "id": "P48739", "url": "https://www.uniprot.org/uniprot/P48739#function" }, { "database": "UniProtKB", "id": "Q9TR36", "url": "https://www.uniprot.org/uniprot/Q9TR36#function" }, { "database": "PubMed", "id": "18636990", "url": "https://glygen.org/publication/PubMed/18636990" } ] }, { "annotation": "In rat liver, the single gene for PITPbeta gives rise to seven distinct protein species that can be resolved on the basis of their charge differences", "evidence": [ { "database": "RefSeq", "id": "NP_446194", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446194" }, { "database": "PubMed", "id": "16780419", "url": "https://glygen.org/publication/PubMed/16780419" } ] }, { "annotation": "Lower protein expression of PI-TP(alpha and beta) in aged brain and in PD.", "evidence": [ { "database": "RefSeq", "id": "NP_446194", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446194" }, { "database": "PubMed", "id": "16779671", "url": "https://glygen.org/publication/PubMed/16779671" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 202, "end_pos": 203, "sequence_org": "WW", "sequence_mut": "AA", "comment": "Loss of Golgi membrane localization.", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" }, { "database": "PubMed", "id": "18636990", "url": "https://glygen.org/publication/PubMed/18636990" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "common_name": "Rat" } ], "gene": [ { "name": "Pitpnb", "url": "https://www.uniprot.org/uniprot/P53812", "locus": { "chromosome": "12", "start_pos": 45249333, "end_pos": 45298314, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000000665", "url": "https://www.ensembl.org/id/ENSRNOG00000000665" } ] } } ], "crossref": [ { "id": "ENSRNOG00000000665", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000000665", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd08888", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08888", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "114561", "url": "https://www.ncbi.nlm.nih.gov/gene/114561", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001666", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001666", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023393", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023393", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:114561", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:114561", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FIIESRH", "url": "https://omabrowser.org/oma/group/FIIESRH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3946034at2759", "url": "http://www.orthodb.org/?query=3946034at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10658", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10658", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10658:SF27", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10658:SF27", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2A1L", "url": "https://www.rcsb.org/structure/2A1L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF02121", "url": "http://pfam.xfam.org/family/PF02121", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P53812", "url": "http://purl.obolibrary.org/obo/PR_P53812", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-1483196", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1483196", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_446194", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446194", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "620143", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=620143", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "38571", "url": "https://www.rhea-db.org/rhea/38571", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38691", "url": "https://www.rhea-db.org/rhea/38691", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "43776", "url": "https://www.rhea-db.org/rhea/43776", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8I6ARL3", "url": "https://www.uniprot.org/uniprot/A0A8I6ARL3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ARL3-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ARL3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2UMX1", "url": "https://www.uniprot.org/uniprot/A0A8L2UMX1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2UMX1-1", "url": "https://www.uniprot.org/uniprot/A0A8L2UMX1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZCD4", "url": "https://www.uniprot.org/uniprot/D3ZCD4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZCD4-1", "url": "https://www.uniprot.org/uniprot/D3ZCD4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53812-1", "url": "https://www.uniprot.org/uniprot/P53812-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53812-2", "url": "https://www.uniprot.org/uniprot/P53812-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANTPDCPKMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA", "length": 271, "header": "sp|P53812-1|PIPNB_RAT Isoform 1 of Phosphatidylinositol transfer protein beta isoform OS=Rattus norvegicus OX=10116 GN=Pitpnb PE=1 SV=2 CANONICAL=P53812-1" }, "isoforms": [ { "isoform_ac": "A0A8I6ARL3-1", "url": "", "sequence": { "sequence": "NLVLKHLRIVYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTSKLNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANTPDCPKMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETVSLAVVAVSALYNCTCLARLFLFPCLFSPEWSFPDTNALRPS", "length": 291, "header": "tr|A0A8I6ARL3-1|PIPNB_RAT Computationally mapped isoform of Phosphatidylinositol transfer protein beta isoform OS=Rattus norvegicus OX=10116 GN=Pitpnb PE=1 SV=1 CANONICAL=P53812-1" }, "locus": { "chromosome": "12", "start_pos": 45292827, "end_pos": 45254336, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000115109.1", "url": "https://www.ensembl.org/id/ENSRNOT00000115109.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000091407.1", "url": "https://www.ensembl.org/id/ENSRNOP00000091407.1" } ] } }, { "isoform_ac": "A0A8L2UMX1-1", "url": "", "sequence": { "sequence": "NLVLKHLRIVYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTSKLNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANTPDCPKMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETVSLAVVAVESKACPGPSKQSS", "length": 270, "header": "tr|A0A8L2UMX1-1|A0A8L2UMX1_RAT Computationally mapped isoform of Phosphatidylinositol transfer protein, beta OS=Rattus norvegicus OX=10116 GN=Pitpnb PE=1 SV=1 CANONICAL=P53812-1" }, "locus": { "chromosome": "12", "start_pos": 45292827, "end_pos": 45253914, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000066892.5", "url": "https://www.ensembl.org/id/ENSRNOT00000066892.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000058957.4", "url": "https://www.ensembl.org/id/ENSRNOP00000058957.4" } ] } }, { "isoform_ac": "D3ZCD4-1", "url": "", "sequence": { "sequence": "MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTILQNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANTPDCPKMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETLRSQGQVRGTSAACDD", "length": 272, "header": "tr|D3ZCD4-1|PIPNB_RAT Computationally mapped isoform of Phosphatidylinositol transfer protein beta isoform OS=Rattus norvegicus OX=10116 GN=Pitpnb PE=1 SV=3 CANONICAL=P53812-1" }, "locus": {} }, { "isoform_ac": "P53812-1", "url": "", "sequence": { "sequence": "MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANTPDCPKMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA", "length": 271, "header": "sp|P53812-1|PIPNB_RAT Isoform 1 of Phosphatidylinositol transfer protein beta isoform OS=Rattus norvegicus OX=10116 GN=Pitpnb PE=1 SV=2 CANONICAL=P53812-1" }, "locus": { "chromosome": "12", "start_pos": 45298258, "end_pos": 45252104, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000115325", "url": "https://www.ensembl.org/id/ENSRNOT00000115325" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000078649", "url": "https://www.ensembl.org/id/ENSRNOP00000078649" } ] } }, { "isoform_ac": "P53812-2", "url": "", "sequence": { "sequence": "MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANTPDCPKMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETLRSQGQVRGTSAACDD", "length": 272, "header": "sp|P53812-2|PIPNB_RAT Isoform 2 of Phosphatidylinositol transfer protein beta isoform OS=Rattus norvegicus OX=10116 GN=Pitpnb PE=1 SV=2 CANONICAL=P53812-1" }, "locus": { "chromosome": "12", "start_pos": 45298258, "end_pos": 45251057, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000052202", "url": "https://www.ensembl.org/id/ENSRNOT00000052202" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000050368", "url": "https://www.ensembl.org/id/ENSRNOP00000050368" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 262, "end_pos": 262, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "site_lbl": "Ser262" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Phosphatidylinositol transfer protein expression altered by aging and Parkinson disease.", "journal": "Cellular and molecular neurobiology", "date": "2006", "authors": "Chalimoniuk M, Snoek GT, Adamczyk A, Malecki A, Strosznajder JB", "evidence": [ { "database": "RefSeq", "id": "NP_446194", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446194" } ], "reference": [ { "type": "PubMed", "id": "16779671", "url": "https://glygen.org/publication/PubMed/16779671" } ] }, { "title": "Differential expression of a C-terminal splice variant of phosphatidylinositol transfer protein beta lacking the constitutive-phosphorylated Ser262 that localizes to the Golgi compartment.", "journal": "The Biochemical journal", "date": "2006", "authors": "Morgan CP, Allen-Baume V, Radulovic M, Li M, Skippen A, Cockcroft S", "evidence": [ { "database": "RefSeq", "id": "NP_446194", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446194" } ], "reference": [ { "type": "PubMed", "id": "16780419", "url": "https://glygen.org/publication/PubMed/16780419" } ] }, { "title": "Dynamics of lipid transfer by phosphatidylinositol transfer proteins in cells.", "journal": "Traffic", "date": "2008", "authors": "Shadan S, Holic R, Carvou N, Ee P, Li M, Murray-Rust J, Cockcroft S", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "reference": [ { "type": "PubMed", "id": "18636990", "url": "https://glygen.org/publication/PubMed/18636990" } ] }, { "title": "Cloning of a cDNA encoding a second phosphatidylinositol transfer protein of rat brain by complementation of the yeast sec14 mutation.", "journal": "J. Biochem.", "date": "1994", "authors": "Tanaka S., Hosaka K.", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "reference": [ { "type": "PubMed", "id": "7961615", "url": "https://glygen.org/publication/PubMed/7961615" } ] } ], "pathway": [ { "id": "rno:114561", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:114561", "resource": "KEGG Pathway" }, { "id": "R-RNO-1483196", "name": "PI and PC transport between ER and Golgi membranes", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1483196", "resource": "Reactome", "description": "PI and PC transport between ER and Golgi membranes" } ], "orthologs": [ { "uniprot_canonical_ac": "P48739-1", "protein_name": "Phosphatidylinositol transfer protein beta isoform", "gene_name": "PITPNB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV", "length": 271 }, "evidence": [ { "id": "45232691", "url": "http://www.informatics.jax.org/homology/45232691", "database": "MGI" }, { "id": "P53812", "url": "https://omabrowser.org/oma/group/P53812/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P53811-1", "protein_name": "Phosphatidylinositol transfer protein beta isoform", "gene_name": "Pitpnb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFHSVKTKRGPLGPNWKKELANTPDCPRMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA", "length": 271 }, "evidence": [ { "id": "45232691", "url": "http://www.informatics.jax.org/homology/45232691", "database": "MGI" }, { "id": "P53812", "url": "https://omabrowser.org/oma/group/P53812/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "phospholipid transporter activity", "id": "GO:0005548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005548", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "phosphatidylcholine binding", "id": "GO:0031210", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031210", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "phosphatidylinositol binding", "id": "GO:0035091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035091", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "phosphatidylinositol transfer activity", "id": "GO:0008526", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008526", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "phosphatidylcholine transporter activity", "id": "GO:0008525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008525", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "phosphatidylcholine transfer activity", "id": "GO:0120019", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120019", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "sphingomyelin transfer activity", "id": "GO:0140338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140338", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "in utero embryonic development", "id": "GO:0001701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001701", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "phospholipid transport", "id": "GO:0015914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015914", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" }, { "name": "retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum", "id": "GO:0006890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006890", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 32, "end_pos": 34, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Constitutive phosphorylation of Ser-262 has no effect on phospholipid transfer activity but is required for Golgi targeting.", "evidence": [ { "database": "UniProtKB", "id": "P53812", "url": "https://www.uniprot.org/uniprot/P53812" }, { "database": "PubMed", "id": "P53811", "url": "https://glygen.org/publication/PubMed/P53811" } ] } ], "interactions": [], "reactions": [ { "id": "38571", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P58195-1", "O15162-1", "Q9JJ00-1" ], "evidence": [ { "id": "38571", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38571" } ] }, { "id": "38691", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol)(in) = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "38691", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38691" } ] }, { "id": "43776", "name": "", "equation": "an N-(acyl)-sphingosylphosphocholine(in) = an N-(acyl)-sphingosylphosphocholine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "43776", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/43776" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O15162", "gene_name": "PLSCR1", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "O15162", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15162" } ] } ] }, { "uniprot_ac": "P58195", "gene_name": "Plscr1", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "P58195", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58195" } ] } ] }, { "uniprot_ac": "Q9JJ00", "gene_name": "Plscr1", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q9JJ00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ00" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }