{ "uniprot_canonical_ac": "P53539-1", "uniprot_ac": "P53539", "uniprot_id": "FOSB_HUMAN", "mass": { "chemical_mass": 35928.0, "monoisotopic_mass": 35928.0 }, "refseq": { "ac": "NP_001107643", "name": "protein FosB isoform 2", "summary": "The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" }, "gene_names": [ { "name": "FOSB", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P53539", "id": "P53539" }, { "name": "AP-1; G0S3; GOS3; GOSB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643", "id": "NP_001107643" }, { "name": "FOSB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643", "id": "NP_001107643" }, { "name": "G0S3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P53539", "id": "P53539" } ], "protein_names": [ { "name": "Protein FosB", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P53539" }, { "name": "FosB proto-oncogene, AP-1 transcription factor subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53539" }, { "name": "G0/G1 switch regulatory protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53539" }, { "name": "Transcription factor AP-1 subunit FosB", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P53539" }, { "name": "activator protein 1; G0/G1 switch regulatory protein 3; FBJ murine osteosarcoma viral oncogene homolog B; FosB proto-oncogene, AP-1 trancription factor subunit; transcription factor AP-1 subunit FosB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643", "id": "NP_001107643" }, { "name": "protein FosB isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643", "id": "NP_001107643" } ], "function": [ { "annotation": "Exhibits lower transactivation activity than isoform 1 in vitro (By similarity). The heterodimer with JUN does not display any transcriptional activity, and may thereby act as an transcriptional inhibitor (By similarity). May be involved in the regulation of neurogenesis in the hippocampus (By similarity). May play a role in synaptic modifications in nucleus accumbens medium spiny neurons and thereby play a role in adaptive and pathological reward-dependent learning, including maladaptive responses involved in drug addiction (By similarity). Seems to be more stably expressed with a half-life of ~9.5 hours in cell culture as compared to 1.5 hours half-life of isoform 1 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539#function" }, { "database": "UniProtKB", "id": "P13346", "url": "https://www.uniprot.org/uniprot/P13346#function" } ] }, { "annotation": "Expression of SARS-CoV-2 receptor angiotensin-converting enzyme 2 by activating protein-1 in human mast cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" }, { "database": "PubMed", "id": "36898276", "url": "https://glygen.org/publication/PubMed/36898276" } ] }, { "annotation": "Heterodimerizes with proteins of the JUN family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to gene promoters containing an AP-1 consensus sequence 5'-TGA[GC]TCA-3' and enhancing their transcriptional activity (PubMed:12618758, PubMed:28981703). As part of the AP-1 complex, facilitates enhancer selection together with cell-type-specific transcription factors by collaboratively binding to nucleosomal enhancers and recruiting the SWI/SNF (BAF) chromatin remodeling complex to establish accessible chromatin (By similarity). Together with JUN, plays a role in activation-induced cell death of T cells by binding to the AP-1 promoter site of FASLG/CD95L, and inducing its transcription in response to activation of the TCR/CD3 signaling pathway (PubMed:12618758). Exhibits transactivation activity in vitro (By similarity). Involved in the display of nurturing behavior towards newborns (By similarity). May play a role in neurogenesis in the hippocampus and in learning and memory-related tasks by regulating the expression of various genes involved in neurogenesis, depression and epilepsy (By similarity). Implicated in behavioral responses related to morphine reward and spatial memory (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539#function" }, { "database": "PubMed", "id": "28981703", "url": "https://glygen.org/publication/PubMed/28981703" }, { "database": "UniProtKB", "id": "P13346", "url": "https://www.uniprot.org/uniprot/P13346#function" }, { "database": "PubMed", "id": "12618758", "url": "https://glygen.org/publication/PubMed/12618758" } ] }, { "annotation": "Identifying DUSP-1 and FOSB as hub genes in immunoglobulin A nephropathy by WGCNA and DEG screening and validation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" }, { "database": "PubMed", "id": "35910761", "url": "https://glygen.org/publication/PubMed/35910761" } ] }, { "annotation": "Inflammatory lobular hemangioma (T-cell-rich angiomatoid polypoid pseudolymphoma)-Assessment of FOS/FOSB and lymphoid markers and comparison with epithelioid hemangioma.", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" }, { "database": "PubMed", "id": "36008878", "url": "https://glygen.org/publication/PubMed/36008878" } ] }, { "annotation": "Knockout of FosB gene changes drug sensitivity and invasion activity via the regulation of Bcl-2, E-cadherin, beta-catenin, and vimentin expression.", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" }, { "database": "PubMed", "id": "34153682", "url": "https://glygen.org/publication/PubMed/34153682" } ] }, { "annotation": "The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" } ] }, { "annotation": "[The Prognostic Value of FOSB Gene in Acute Myeloid Leukemia].", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" }, { "database": "PubMed", "id": "35981363", "url": "https://glygen.org/publication/PubMed/35981363" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs879647443", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs879647443" }, { "id": "rs879647443", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs879647443" }, { "id": "rs879647443", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs879647443" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 299, "end_pos": 299, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "19", "chr_pos": "45472891", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S299", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1209322615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1209322615" }, { "id": "rs1209322615", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1209322615" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 64, "end_pos": 64, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "19", "chr_pos": "45470840", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S64", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs893394294", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs893394294" }, { "id": "rs893394294", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs893394294" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 9, "end_pos": 9, "sequence_org": "Y", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YDS->NDS).", "chr_id": "19", "chr_pos": "45468611", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y9", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "63.27", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "71.39", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "72.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "73.5", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "90.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "65.19", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "74.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "98.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "68.86", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "75.18", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "76.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P53539", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P53539" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "common_name": "Human" } ], "gene": [ { "name": "FOSB", "url": "https://www.uniprot.org/uniprot/P53539", "locus": { "chromosome": "19", "start_pos": 45475179, "end_pos": 45467995, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000125740", "url": "https://www.ensembl.org/id/ENSG00000125740" } ] } } ], "crossref": [ { "id": "ENSG00000125740", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125740", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd14721", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14721", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4630821", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4630821", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "FOSB", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FOSB", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "2354", "url": "https://www.ncbi.nlm.nih.gov/gene/2354", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "3797", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3797", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P53539", "url": "https://www.ebi.ac.uk/intact/interactors/id:P53539*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000837", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000837", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004827", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004827", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2354", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2354", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "164772", "url": "http://www.omim.org/entry/164772", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P53539", "url": "https://www.nextprot.org/entry/NX_P53539", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "P53539", "url": "https://oglcnac.org/atlas/detail/P53539", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P53539", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P53539", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MMQEVAF", "url": "https://omabrowser.org/oma/group/MMQEVAF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4260878at2759", "url": "http://www.orthodb.org/?query=4260878at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23351", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23351", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23351:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23351:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5VPA", "url": "https://www.rcsb.org/structure/5VPA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VPB", "url": "https://www.rcsb.org/structure/5VPB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VPC", "url": "https://www.rcsb.org/structure/5VPC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VPD", "url": "https://www.rcsb.org/structure/5VPD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VPE", "url": "https://www.rcsb.org/structure/5VPE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VPF", "url": "https://www.rcsb.org/structure/5VPF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UCI", "url": "https://www.rcsb.org/structure/6UCI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UCL", "url": "https://www.rcsb.org/structure/6UCL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UCM", "url": "https://www.rcsb.org/structure/6UCM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UCC", "url": "https://www.rcsb.org/structure/7UCC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UCD", "url": "https://www.rcsb.org/structure/7UCD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00170", "url": "http://pfam.xfam.org/family/PF00170", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P53539", "url": "https://pharos.nih.gov/targets/P53539", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P53539", "url": "http://purl.obolibrary.org/obo/PR_P53539", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "K7EJ89", "url": "https://www.uniprot.org/uniprot/K7EJ89", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EJ89-1", "url": "https://www.uniprot.org/uniprot/K7EJ89-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EKA0", "url": "https://www.uniprot.org/uniprot/K7EKA0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EKA0-1", "url": "https://www.uniprot.org/uniprot/K7EKA0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ERZ8", "url": "https://www.uniprot.org/uniprot/K7ERZ8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ERZ8-1", "url": "https://www.uniprot.org/uniprot/K7ERZ8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-1", "url": "https://www.uniprot.org/uniprot/P53539-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-10", "url": "https://www.uniprot.org/uniprot/P53539-10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-11", "url": "https://www.uniprot.org/uniprot/P53539-11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-2", "url": "https://www.uniprot.org/uniprot/P53539-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-3", "url": "https://www.uniprot.org/uniprot/P53539-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-4", "url": "https://www.uniprot.org/uniprot/P53539-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-5", "url": "https://www.uniprot.org/uniprot/P53539-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-6", "url": "https://www.uniprot.org/uniprot/P53539-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-7", "url": "https://www.uniprot.org/uniprot/P53539-7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-8", "url": "https://www.uniprot.org/uniprot/P53539-8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53539-9", "url": "https://www.uniprot.org/uniprot/P53539-9", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 338, "header": "sp|P53539-1|FOSB_HUMAN Isoform 1 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "isoforms": [ { "isoform_ac": "K7EJ89-1", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETVSKGHQNLAWVGGSKRGRKFLMNGGGLH", "length": 177, "header": "tr|K7EJ89-1|K7EJ89_HUMAN Computationally mapped isoform of FosB proto-oncogene, AP-1 transcription factor subunit OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45471033, "end_pos": 45468587, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000590335.1", "url": "https://www.ensembl.org/id/ENST00000590335.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000465068.1", "url": "https://www.ensembl.org/id/ENSP00000465068.1" } ] } }, { "isoform_ac": "K7EKA0-1", "url": "", "sequence": { "sequence": "MPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAE", "length": 137, "header": "tr|K7EKA0-1|K7EKA0_HUMAN Computationally mapped isoform of FosB proto-oncogene, AP-1 transcription factor subunit OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45471301, "end_pos": 45470650, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000589593.1", "url": "https://www.ensembl.org/id/ENST00000589593.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000465528.1", "url": "https://www.ensembl.org/id/ENSP00000465528.1" } ] } }, { "isoform_ac": "K7ERZ8-1", "url": "", "sequence": { "sequence": "MPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAE", "length": 188, "header": "tr|K7ERZ8-1|K7ERZ8_HUMAN Computationally mapped isoform of FosB proto-oncogene, AP-1 transcription factor subunit OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45472706, "end_pos": 45470650, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000592811.5", "url": "https://www.ensembl.org/id/ENST00000592811.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000468482.1", "url": "https://www.ensembl.org/id/ENSP00000468482.1" } ] } }, { "isoform_ac": "P53539-1", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 338, "header": "sp|P53539-1|FOSB_HUMAN Isoform 1 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45473009, "end_pos": 45468587, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000353609.8", "url": "https://www.ensembl.org/id/ENST00000353609.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000245919.3", "url": "https://www.ensembl.org/id/ENSP00000245919.3" } ] } }, { "isoform_ac": "P53539-10", "url": "", "sequence": { "sequence": "MPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 289, "header": "sp|P53539-10|FOSB_HUMAN Isoform 10 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45473009, "end_pos": 45470650, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000586615.5", "url": "https://www.ensembl.org/id/ENST00000586615.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000468207.1", "url": "https://www.ensembl.org/id/ENSP00000468207.1" } ] } }, { "isoform_ac": "P53539-11", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAE", "length": 237, "header": "sp|P53539-11|FOSB_HUMAN Isoform 11 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45472706, "end_pos": 45468587, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000592436.5", "url": "https://www.ensembl.org/id/ENST00000592436.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000465552.1", "url": "https://www.ensembl.org/id/ENSP00000465552.1" } ] } }, { "isoform_ac": "P53539-2", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 302, "header": "sp|P53539-2|FOSB_HUMAN Isoform 2 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45473009, "end_pos": 45468587, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000417353.6", "url": "https://www.ensembl.org/id/ENST00000417353.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000407207.1", "url": "https://www.ensembl.org/id/ENSP00000407207.1" } ] } }, { "isoform_ac": "P53539-3", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 299, "header": "sp|P53539-3|FOSB_HUMAN Isoform 3 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45473009, "end_pos": 45468587, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000591858.5", "url": "https://www.ensembl.org/id/ENST00000591858.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000466530.1", "url": "https://www.ensembl.org/id/ENSP00000466530.1" } ] } }, { "isoform_ac": "P53539-4", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 291, "header": "sp|P53539-4|FOSB_HUMAN Isoform 4 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45473009, "end_pos": 45468587, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000615753.4", "url": "https://www.ensembl.org/id/ENST00000615753.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000485018.1", "url": "https://www.ensembl.org/id/ENSP00000485018.1" } ] } }, { "isoform_ac": "P53539-5", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 263, "header": "sp|P53539-5|FOSB_HUMAN Isoform 5 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45473009, "end_pos": 45468587, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000585836.5", "url": "https://www.ensembl.org/id/ENST00000585836.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000467497.1", "url": "https://www.ensembl.org/id/ENSP00000467497.1" } ] } }, { "isoform_ac": "P53539-6", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 255, "header": "sp|P53539-6|FOSB_HUMAN Isoform 6 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": {} }, { "isoform_ac": "P53539-7", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 252, "header": "sp|P53539-7|FOSB_HUMAN Isoform 7 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": {} }, { "isoform_ac": "P53539-8", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 195, "header": "sp|P53539-8|FOSB_HUMAN Isoform 8 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": { "chromosome": "19", "start_pos": 45473009, "end_pos": 45468587, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000443841.6", "url": "https://www.ensembl.org/id/ENST00000443841.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000414177.1", "url": "https://www.ensembl.org/id/ENSP00000414177.1" } ] } }, { "isoform_ac": "P53539-9", "url": "", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL", "length": 148, "header": "sp|P53539-9|FOSB_HUMAN Isoform 9 of Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1 CANONICAL=P53539-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 299, "start_aa": "Ser", "end_pos": 299, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser299", "evidence": [ { "id": "P53539", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P53539" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P53539", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P53539" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 64, "start_aa": "Ser", "end_pos": 64, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser64", "evidence": [ { "id": "P53539", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P53539" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P53539", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P53539" } ] } ], "phosphorylation": [ { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53539", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53539" }, { "database": "PubMed", "id": "17241283", "url": "https://glygen.org/publication/PubMed/17241283" } ], "site_lbl": "Ser27" }, { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" }, { "database": "iPTMnet", "id": "P53539", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53539" }, { "database": "PubMed", "id": "16687504", "url": "https://glygen.org/publication/PubMed/16687504" } ], "site_lbl": "Ser27" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The EGR family of transcription-regulatory factors: progress at the interface of molecular and systems neuroscience.", "journal": "Trends in neurosciences", "date": "1999", "authors": "O'Donovan KJ, Tourtellotte WG, Millbrandt J, Baraban JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10203854", "url": "https://glygen.org/publication/PubMed/10203854" } ] }, { "title": "Staurosporine enhances cAMP-induced expression of neural-specific gene VGF and tyrosine hydroxylase.", "journal": "Neuroscience letters", "date": "1999", "authors": "Nagasaki K, Sasaki K, Maass N, Tsukada T, Hanzawa H, Yamaguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10381005", "url": "https://glygen.org/publication/PubMed/10381005" } ] }, { "title": "Estrogen induction of the cyclin D1 promoter: involvement of a cAMP response-like element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sabbah M, Courilleau D, Mester J, Redeuilh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10500157", "url": "https://glygen.org/publication/PubMed/10500157" } ] }, { "title": "Helix-loop-helix proteins: regulators of transcription in eucaryotic organisms.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Massari ME, Murre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10611221", "url": "https://glygen.org/publication/PubMed/10611221" } ] }, { "title": "Interaction of the Ras-related protein associated with diabetes rad and the putative tumor metastasis suppressor NM23 provides a novel mechanism of GTPase regulation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Zhu J, Tseng YH, Kantor JD, Rhodes CJ, Zetter BR, Moyers JS, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10611312", "url": "https://glygen.org/publication/PubMed/10611312" } ] }, { "title": "Reciprocal Id expression and myelin gene regulation in Schwann cells.", "journal": "Molecular and cellular neurosciences", "date": "1999", "authors": "Thatikunta P, Qin W, Christy BA, Tennekoon GI, Rutkowski JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10656257", "url": "https://glygen.org/publication/PubMed/10656257" } ] }, { "title": "A novel activation function for NAB proteins in EGR-dependent transcription of the luteinizing hormone beta gene.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Sevetson BR, Svaren J, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10734128", "url": "https://glygen.org/publication/PubMed/10734128" } ] }, { "title": "Full promoter sequence of human early growth response factor-1 (Egr-1): demonstration of a fifth functional serum response element.", "journal": "DNA sequence : the journal of DNA sequencing and mapping", "date": "2000", "authors": "Schwachtgen JL, Campbell CJ, Braddock M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10826704", "url": "https://glygen.org/publication/PubMed/10826704" } ] }, { "title": "Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.", "journal": "Journal of molecular endocrinology", "date": "2000", "authors": "Vyhlidal C, Samudio I, Kladde MP, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10828826", "url": "https://glygen.org/publication/PubMed/10828826" } ] }, { "title": "CREB: a stimulus-induced transcription factor activated by a diverse array of extracellular signals.", "journal": "Annual review of biochemistry", "date": "1999", "authors": "Shaywitz AJ, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10872467", "url": "https://glygen.org/publication/PubMed/10872467" } ] }, { "title": "Promoter analysis and chromosomal mapping of human EBAG9 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ikeda K, Sato M, Tsutsumi O, Tsuchiya F, Tsuneizumi M, Emi M, Imoto I, Inazawa J, Muramatsu M, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10873660", "url": "https://glygen.org/publication/PubMed/10873660" } ] }, { "title": "VGF: a novel role for this neuronal and neuroendocrine polypeptide in the regulation of energy balance.", "journal": "Frontiers in neuroendocrinology", "date": "2000", "authors": "Salton SR, Ferri GL, Hahm S, Snyder SE, Wilson AJ, Possenti R, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10882540", "url": "https://glygen.org/publication/PubMed/10882540" } ] }, { "title": "EGR1 target genes in prostate carcinoma cells identified by microarray analysis.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Svaren J, Ehrig T, Abdulkadir SA, Ehrengruber MU, Watson MA, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10984481", "url": "https://glygen.org/publication/PubMed/10984481" } ] }, { "title": "Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chen D, Huang SM, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11010967", "url": "https://glygen.org/publication/PubMed/11010967" } ] }, { "title": "The human transcriptional repressor protein NAB1: expression and biological activity.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Thiel G, Kaufmann K, Magin A, Lietz M, Bach K, Cramer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11018254", "url": "https://glygen.org/publication/PubMed/11018254" } ] }, { "title": "Regulation of Id gene expression during embryonic stem cell-derived hematopoietic differentiation.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Nogueira MM, Mitjavila-Garcia MT, Le Pesteur F, Filippi MD, Vainchenker W, Dubart Kupperschmitt A, Sainteny F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11027551", "url": "https://glygen.org/publication/PubMed/11027551" } ] }, { "title": "MYB oncogene amplification in hereditary BRCA1 breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Kauraniemi P, Hedenfalk I, Persson K, Duggan DJ, Tanner M, Johannsson O, Olsson H, Trent JM, Isola J, Borg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11034064", "url": "https://glygen.org/publication/PubMed/11034064" } ] }, { "title": "PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Ghosh MG, Thompson DA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11103799", "url": "https://glygen.org/publication/PubMed/11103799" } ] }, { "title": "Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription.", "journal": "Cell", "date": "2000", "authors": "Shang Y, Hu X, DiRenzo J, Lazar MA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11136970", "url": "https://glygen.org/publication/PubMed/11136970" } ] }, { "title": "Transcriptional activation of cathepsin D gene expression by 17beta-estradiol: mechanism of aryl hydrocarbon receptor-mediated inhibition.", "journal": "Molecular and cellular endocrinology", "date": "2001", "authors": "Wang F, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11165043", "url": "https://glygen.org/publication/PubMed/11165043" } ] }, { "title": "Regulation of growth and tumorigenicity of breast cancer cells by the low molecular weight GTPase Rad and nm23.", "journal": "Cancer research", "date": "2001", "authors": "Tseng YH, Vicent D, Zhu J, Niu Y, Adeyinka A, Moyers JS, Watson PH, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11280768", "url": "https://glygen.org/publication/PubMed/11280768" } ] }, { "title": "ERK induces p35, a neuron-specific activator of Cdk5, through induction of Egr1.", "journal": "Nature cell biology", "date": "2001", "authors": "Harada T, Morooka T, Ogawa S, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11331872", "url": "https://glygen.org/publication/PubMed/11331872" } ] }, { "title": "Selective targeting of newly synthesized Arc mRNA to active synapses requires NMDA receptor activation.", "journal": "Neuron", "date": "2001", "authors": "Steward O, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11343657", "url": "https://glygen.org/publication/PubMed/11343657" } ] }, { "title": "Transcriptional activation of genes by 17 beta-estradiol through estrogen receptor-Sp1 interactions.", "journal": "Vitamins and hormones", "date": "2001", "authors": "Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11345900", "url": "https://glygen.org/publication/PubMed/11345900" } ] }, { "title": "Estrogen regulation of cyclin D1 gene expression in ZR-75 breast cancer cells involves multiple enhancer elements.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Castro-Rivera E, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11410592", "url": "https://glygen.org/publication/PubMed/11410592" } ] }, { "title": "Estrogen receptor interaction with estrogen response elements.", "journal": "Nucleic acids research", "date": "2001", "authors": "Klinge CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11452016", "url": "https://glygen.org/publication/PubMed/11452016" } ] }, { "title": "Frequent and early loss of the EGR1 corepressor NAB2 in human prostate carcinoma.", "journal": "Human pathology", "date": "2001", "authors": "Abdulkadir SA, Carbone JM, Naughton CK, Humphrey PA, Catalona WJ, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11567222", "url": "https://glygen.org/publication/PubMed/11567222" } ] }, { "title": "Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.", "journal": "Genes & development", "date": "2001", "authors": "Yahata T, Shao W, Endoh H, Hur J, Coser KR, Sun H, Ueda Y, Kato S, Isselbacher KJ, Brown M, Shioda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11581164", "url": "https://glygen.org/publication/PubMed/11581164" } ] }, { "title": "Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2001", "authors": "Metivier R, Penot G, Flouriot G, Pakdel F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11682626", "url": "https://glygen.org/publication/PubMed/11682626" } ] }, { "title": "NGF-dependent and tissue-specific transcription of vgf is regulated by a CREB-p300 and bHLH factor interaction.", "journal": "FEBS letters", "date": "2002", "authors": "Mandolesi G, Gargano S, Pennuto M, Illi B, Molfetta R, Soucek L, Mosca L, Levi A, Jucker R, Nasi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11755530", "url": "https://glygen.org/publication/PubMed/11755530" } ] }, { "title": "The regulation and function of the Id proteins in lymphocyte development.", "journal": "Oncogene", "date": "2001", "authors": "Rivera R, Murre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11840323", "url": "https://glygen.org/publication/PubMed/11840323" } ] }, { "title": "The GTP binding proteins Gem and Rad are negative regulators of the Rho-Rho kinase pathway.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Ward Y, Yap SF, Ravichandran V, Matsumura F, Ito M, Spinelli B, Kelly K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11956230", "url": "https://glygen.org/publication/PubMed/11956230" } ] }, { "title": "Corepressor-dependent silencing of chromosomal regions encoding neuronal genes.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Lunyak VV, Burgess R, Prefontaine GG, Nelson C, Sze SH, Chenoweth J, Schwartz P, Pevzner PA, Glass C, Mandel G, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "12399542", "url": "https://glygen.org/publication/PubMed/12399542" } ] }, { "title": "Crosstalk between CARM1 methylation and CBP acetylation on histone H3.", "journal": "Current biology : CB", "date": "2002", "authors": "Daujat S, Bauer UM, Shah V, Turner B, Berger S, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12498683", "url": "https://glygen.org/publication/PubMed/12498683" } ] }, { "title": "Synthesis of serotonin by a second tryptophan hydroxylase isoform.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Walther DJ, Peter JU, Bashammakh S, Hortnagl H, Voits M, Fink H, Bader M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "12511643", "url": "https://glygen.org/publication/PubMed/12511643" } ] }, { "title": "Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ballare C, Uhrig M, Bechtold T, Sancho E, Di Domenico M, Migliaccio A, Auricchio F, Beato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12612073", "url": "https://glygen.org/publication/PubMed/12612073" } ] }, { "title": "An unexpected role for FosB in activation-induced cell death of T cells.", "journal": "Oncogene", "date": "2003", "authors": "Baumann S, Hess J, Eichhorst ST, Krueger A, Angel P, Krammer PH, Kirchhoff S", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "reference": [ { "type": "PubMed", "id": "12618758", "url": "https://glygen.org/publication/PubMed/12618758" } ] }, { "title": "Profiling of estrogen up- and down-regulated gene expression in human breast cancer cells: insights into gene networks and pathways underlying estrogenic control of proliferation and cell phenotype.", "journal": "Endocrinology", "date": "2003", "authors": "Frasor J, Danes JM, Komm B, Chang KC, Lyttle CR, Katzenellenbogen BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12959972", "url": "https://glygen.org/publication/PubMed/12959972" } ] }, { "title": "Automated DNA sequencing and analysis of 106 kilobases from human chromosome 19q13.3.", "journal": "Nat. Genet.", "date": "1992", "authors": "Martin-Gallardo A, McCombie WR, Gocayne JD, FitzGerald MG, Wallace S, Lee BM, Lamerdin J, Trapp S, Kelley JM, Liu LI, et al.", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "reference": [ { "type": "PubMed", "id": "1301997", "url": "https://glygen.org/publication/PubMed/1301997" } ] }, { "title": "NGF induces the expression of the VGF gene through a cAMP response element.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1992", "authors": "Hawley RJ, Scheibe RJ, Wagner JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1377233", "url": "https://glygen.org/publication/PubMed/1377233" } ] }, { "title": "Local regulation of fat metabolism in peripheral nerves.", "journal": "Genes & development", "date": "2003", "authors": "Verheijen MH, Chrast R, Burrola P, Lemke G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "14522948", "url": "https://glygen.org/publication/PubMed/14522948" } ] }, { "title": "Disruption of the nonneuronal tph1 gene demonstrates the importance of peripheral serotonin in cardiac function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Cote F, Thevenot E, Fligny C, Fromes Y, Darmon M, Ripoche MA, Bayard E, Hanoun N, Saurini F, Lechat P, Dandolo L, Hamon M, Mallet J, Vodjdani G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "14597720", "url": "https://glygen.org/publication/PubMed/14597720" } ] }, { "title": "Acetylation and methylation in nuclear receptor gene activation.", "journal": "Methods in enzymology", "date": "2003", "authors": "Xu W, Cho H, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14631847", "url": "https://glygen.org/publication/PubMed/14631847" } ] }, { "title": "Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter.", "journal": "Cell", "date": "2003", "authors": "Metivier R, Penot G, Hubner MR, Reid G, Brand H, Kos M, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14675539", "url": "https://glygen.org/publication/PubMed/14675539" } ] }, { "title": "Muscarinic acetylcholine receptor stimulation induces expression of the activity-regulated cytoskeleton-associated gene (ARC).", "journal": "Brain research. Molecular brain research", "date": "2004", "authors": "Teber I, Kohling R, Speckmann EJ, Barnekow A, Kremerskothen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "14969744", "url": "https://glygen.org/publication/PubMed/14969744" } ] }, { "title": "Genome-wide identification of high-affinity estrogen response elements in human and mouse.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Bourdeau V, Deschenes J, Metivier R, Nagai Y, Nguyen D, Bretschneider N, Gannon F, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15001666", "url": "https://glygen.org/publication/PubMed/15001666" } ] }, { "title": "Rho kinase regulates schwann cell myelination and formation of associated axonal domains.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Melendez-Vasquez CV, Einheber S, Salzer JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15102911", "url": "https://glygen.org/publication/PubMed/15102911" } ] }, { "title": "Neurotrophins regulate Schwann cell migration by activating divergent signaling pathways dependent on Rho GTPases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Yamauchi J, Chan JR, Shooter EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15161978", "url": "https://glygen.org/publication/PubMed/15161978" } ] }, { "title": "Cellular control of gene expression by T-type cyclin/CDK9 complexes.", "journal": "Gene", "date": "2004", "authors": "Garriga J, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15276198", "url": "https://glygen.org/publication/PubMed/15276198" } ] }, { "title": "Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cicatiello L, Addeo R, Sasso A, Altucci L, Petrizzi VB, Borgo R, Cancemi M, Caporali S, Caristi S, Scafoglio C, Teti D, Bresciani F, Perillo B, Weisz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15282324", "url": "https://glygen.org/publication/PubMed/15282324" } ] }, { "title": "Transcriptional complexes engaged by apo-estrogen receptor-alpha isoforms have divergent outcomes.", "journal": "The EMBO journal", "date": "2004", "authors": "Metivier R, Penot G, Carmouche RP, Hubner MR, Reid G, Denger S, Manu D, Brand H, Kos M, Benes V, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15343269", "url": "https://glygen.org/publication/PubMed/15343269" } ] }, { "title": "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.", "journal": "Genome biology", "date": "2004", "authors": "Lin CY, Strom A, Vega VB, Kong SL, Yeo AL, Thomsen JS, Chan WC, Doray B, Bangarusamy DK, Ramasamy A, Vergara LA, Tang S, Chong A, Bajic VB, Miller LD, Gustafsson JA, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15345050", "url": "https://glygen.org/publication/PubMed/15345050" } ] }, { "title": "Egr-1 is activated by 17beta-estradiol in MCF-7 cells by mitogen-activated protein kinase-dependent phosphorylation of ELK-1.", "journal": "Journal of cellular biochemistry", "date": "2004", "authors": "Chen CC, Lee WR, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15449318", "url": "https://glygen.org/publication/PubMed/15449318" } ] }, { "title": "Global gene expression analysis of estrogen receptor transcription factor cross talk in breast cancer: identification of estrogen-induced/activator protein-1-dependent genes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "DeNardo DG, Kim HT, Hilsenbeck S, Cuba V, Tsimelzon A, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15514030", "url": "https://glygen.org/publication/PubMed/15514030" } ] }, { "title": "Ternary complex factor-serum response factor complex-regulated gene activity is required for cellular proliferation and inhibition of apoptotic cell death.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Vickers ER, Kasza A, Kurnaz IA, Seifert A, Zeef LA, O'donnell A, Hayes A, Sharrocks AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15542842", "url": "https://glygen.org/publication/PubMed/15542842" } ] }, { "title": "Defining the CREB regulon: a genome-wide analysis of transcription factor regulatory regions.", "journal": "Cell", "date": "2004", "authors": "Impey S, McCorkle SR, Cha-Molstad H, Dwyer JM, Yochum GS, Boss JM, McWeeney S, Dunn JJ, Mandel G, Goodman RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15620361", "url": "https://glygen.org/publication/PubMed/15620361" } ] }, { "title": "Regulatory elements in the promoter region of vgf, a nerve growth factor-inducible gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Possenti R, Di Rocco G, Nasi S, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1570299", "url": "https://glygen.org/publication/PubMed/1570299" } ] }, { "title": "Serum/glucocorticoid-inducible kinase can phosphorylate the cyclic AMP response element binding protein, CREB.", "journal": "FEBS letters", "date": "2005", "authors": "David S, Kalb RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15733869", "url": "https://glygen.org/publication/PubMed/15733869" } ] }, { "title": "Regulation of cholesterol/lipid biosynthetic genes by Egr2/Krox20 during peripheral nerve myelination.", "journal": "Journal of neurochemistry", "date": "2005", "authors": "Leblanc SE, Srinivasan R, Ferri C, Mager GM, Gillian-Daniel AL, Wrabetz L, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15836632", "url": "https://glygen.org/publication/PubMed/15836632" } ] }, { "title": "SRF mediates activity-induced gene expression and synaptic plasticity but not neuronal viability.", "journal": "Nature neuroscience", "date": "2005", "authors": "Ramanan N, Shen Y, Sarsfield S, Lemberger T, Schutz G, Linden DJ, Ginty DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15880109", "url": "https://glygen.org/publication/PubMed/15880109" } ] }, { "title": "GREB 1 is a critical regulator of hormone dependent breast cancer growth.", "journal": "Breast cancer research and treatment", "date": "2005", "authors": "Rae JM, Johnson MD, Scheys JO, Cordero KE, Larios JM, Lippman ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15986123", "url": "https://glygen.org/publication/PubMed/15986123" } ] }, { "title": "Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1.", "journal": "Cell", "date": "2005", "authors": "Carroll JS, Liu XS, Brodsky AS, Li W, Meyer CA, Szary AJ, Eeckhoute J, Shao W, Hestermann EV, Geistlinger TR, Fox EA, Silver PA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16009131", "url": "https://glygen.org/publication/PubMed/16009131" } ] }, { "title": "Id family of helix-loop-helix proteins in cancer.", "journal": "Nature reviews. Cancer", "date": "2005", "authors": "Perk J, Iavarone A, Benezra R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16034366", "url": "https://glygen.org/publication/PubMed/16034366" } ] }, { "title": "Cathepsin D: newly discovered functions of a long-standing aspartic protease in cancer and apoptosis.", "journal": "Cancer letters", "date": "2006", "authors": "Liaudet-Coopman E, Beaujouin M, Derocq D, Garcia M, Glondu-Lassis M, Laurent-Matha V, Prebois C, Rochefort H, Vignon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16046058", "url": "https://glygen.org/publication/PubMed/16046058" } ] }, { "title": "From the Cover: Location analysis of estrogen receptor alpha target promoters reveals that FOXA1 defines a domain of the estrogen response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Laganiere J, Deblois G, Lefebvre C, Bataille AR, Robert F, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16087863", "url": "https://glygen.org/publication/PubMed/16087863" } ] }, { "title": "Downstream targets of growth factor and oestrogen signalling and endocrine resistance: the potential roles of c-Myc, cyclin D1 and cyclin E.", "journal": "Endocrine-related cancer", "date": "2005", "authors": "Butt AJ, McNeil CM, Musgrove EA, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16113099", "url": "https://glygen.org/publication/PubMed/16113099" } ] }, { "title": "Nab proteins are essential for peripheral nervous system myelination.", "journal": "Nature neuroscience", "date": "2005", "authors": "Le N, Nagarajan R, Wang JY, Svaren J, LaPash C, Araki T, Schmidt RE, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16136673", "url": "https://glygen.org/publication/PubMed/16136673" } ] }, { "title": "BMP enhances transcriptional responses to NGF during PC12 cell differentiation.", "journal": "Neurochemical research", "date": "2005", "authors": "Lonn P, Zaia K, Israelsson C, Althini S, Usoskin D, Kylberg A, Ebendal T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16187211", "url": "https://glygen.org/publication/PubMed/16187211" } ] }, { "title": "A prohormone convertase cleavage site within a predicted alpha-helix mediates sorting of the neuronal and endocrine polypeptide VGF into the regulated secretory pathway.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Garcia AL, Han SK, Janssen WG, Khaing ZZ, Ito T, Glucksman MJ, Benson DL, Salton SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16221685", "url": "https://glygen.org/publication/PubMed/16221685" } ] }, { "title": "Egr-1 induces the expression of its corepressor nab2 by activation of the nab2 promoter thereby establishing a negative feedback loop.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kumbrink J, Gerlinger M, Johnson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16260776", "url": "https://glygen.org/publication/PubMed/16260776" } ] }, { "title": "The neuroplasticity-associated arc gene is a direct transcriptional target of early growth response (Egr) transcription factors.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Li L, Carter J, Gao X, Whitehead J, Tourtellotte WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16287845", "url": "https://glygen.org/publication/PubMed/16287845" } ] }, { "title": "Mechanism of estrogen activation of c-myc oncogene expression.", "journal": "Oncogene", "date": "1992", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "1630819", "url": "https://glygen.org/publication/PubMed/1630819" } ] }, { "title": "Immediate-early gene-encoded protein Arc is associated with synaptic delivery of GluR4-containing AMPA receptors during in vitro classical conditioning.", "journal": "Journal of neurophysiology", "date": "2006", "authors": "Mokin M, Lindahl JS, Keifer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16339507", "url": "https://glygen.org/publication/PubMed/16339507" } ] }, { "title": "Late developmental stage-specific role of tryptophan hydroxylase 1 in brain serotonin levels.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2006", "authors": "Nakamura K, Sugawara Y, Sawabe K, Ohashi A, Tsurui H, Xiu Y, Ohtsuji M, Lin QS, Nishimura H, Hasegawa H, Hirose S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16407550", "url": "https://glygen.org/publication/PubMed/16407550" } ] }, { "title": "Activity-dependent regulation of MEF2 transcription factors suppresses excitatory synapse number.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Flavell SW, Cowan CW, Kim TK, Greer PL, Lin Y, Paradis S, Griffith EC, Hu LS, Chen C, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16484497", "url": "https://glygen.org/publication/PubMed/16484497" } ] }, { "title": "NAB2 represses transcription by interacting with the CHD4 subunit of the nucleosome remodeling and deacetylase (NuRD) complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Srinivasan R, Mager GM, Ward RM, Mayer J, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16574654", "url": "https://glygen.org/publication/PubMed/16574654" } ] }, { "title": "Regulation of DeltaFosB stability by phosphorylation.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2006", "authors": "Ulery PG, Rudenko G, Nestler EJ", "evidence": [ { "database": "iPTMnet", "id": "P53539", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53539" } ], "reference": [ { "type": "PubMed", "id": "16687504", "url": "https://glygen.org/publication/PubMed/16687504" } ] }, { "title": "AMPA receptors regulate transcription of the plasticity-related immediate-early gene Arc.", "journal": "Nature neuroscience", "date": "2006", "authors": "Rao VR, Pintchovski SA, Chin J, Peebles CL, Mitra S, Finkbeiner S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16732277", "url": "https://glygen.org/publication/PubMed/16732277" } ] }, { "title": "A cell-type-specific transcriptional network required for estrogen regulation of cyclin D1 and cell cycle progression in breast cancer.", "journal": "Genes & development", "date": "2006", "authors": "Eeckhoute J, Carroll JS, Geistlinger TR, Torres-Arzayus MI, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16980581", "url": "https://glygen.org/publication/PubMed/16980581" } ] }, { "title": "Genome-wide analysis of estrogen receptor binding sites.", "journal": "Nature genetics", "date": "2006", "authors": "Carroll JS, Meyer CA, Song J, Li W, Geistlinger TR, Eeckhoute J, Brodsky AS, Keeton EK, Fertuck KC, Hall GF, Wang Q, Bekiranov S, Sementchenko V, Fox EA, Silver PA, Gingeras TR, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17013392", "url": "https://glygen.org/publication/PubMed/17013392" } ] }, { "title": "Arc/Arg3.1 is essential for the consolidation of synaptic plasticity and memories.", "journal": "Neuron", "date": "2006", "authors": "Plath N, Ohana O, Dammermann B, Errington ML, Schmitz D, Gross C, Mao X, Engelsberg A, Mahlke C, Welzl H, Kobalz U, Stawrakakis A, Fernandez E, Waltereit R, Bick-Sander A, Therstappen E, Cooke SF, Blanquet V, Wurst W, Salmen B, Bosl MR, Lipp HP, Grant SG, Bliss TV, Wolfer DP, Kuhl D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17088210", "url": "https://glygen.org/publication/PubMed/17088210" } ] }, { "title": "Arc/Arg3.1 interacts with the endocytic machinery to regulate AMPA receptor trafficking.", "journal": "Neuron", "date": "2006", "authors": "Chowdhury S, Shepherd JD, Okuno H, Lyford G, Petralia RS, Plath N, Kuhl D, Huganir RL, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17088211", "url": "https://glygen.org/publication/PubMed/17088211" } ] }, { "title": "Increased expression of the immediate-early gene arc/arg3.1 reduces AMPA receptor-mediated synaptic transmission.", "journal": "Neuron", "date": "2006", "authors": "Rial Verde EM, Lee-Osbourne J, Worley PF, Malinow R, Cline HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17088212", "url": "https://glygen.org/publication/PubMed/17088212" } ] }, { "title": "Regulation of DeltaFosB transcriptional activity by Ser27 phosphorylation.", "journal": "The European journal of neuroscience", "date": "2007", "authors": "Ulery PG, Nestler EJ", "evidence": [ { "database": "iPTMnet", "id": "P53539", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53539" } ], "reference": [ { "type": "PubMed", "id": "17241283", "url": "https://glygen.org/publication/PubMed/17241283" } ] }, { "title": "Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.", "journal": "Nature cell biology", "date": "2007", "authors": "Wissmann M, Yin N, Muller JM, Greschik H, Fodor BD, Jenuwein T, Vogler C, Schneider R, Gunther T, Buettner R, Metzger E, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17277772", "url": "https://glygen.org/publication/PubMed/17277772" } ] }, { "title": "Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Deschenes J, Bourdeau V, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17463000", "url": "https://glygen.org/publication/PubMed/17463000" } ] }, { "title": "The DEAD-box p68/p72 proteins and the noncoding RNA steroid receptor activator SRA: eclectic regulators of disparate biological functions.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Caretti G, Lei EP, Sartorelli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17495528", "url": "https://glygen.org/publication/PubMed/17495528" } ] }, { "title": "Novel estrogen receptor-alpha binding sites and estradiol target genes identified by chromatin immunoprecipitation cloning in breast cancer.", "journal": "Cancer research", "date": "2007", "authors": "Lin Z, Reierstad S, Huang CC, Bulun SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17510434", "url": "https://glygen.org/publication/PubMed/17510434" } ] }, { "title": "The EJC factor eIF4AIII modulates synaptic strength and neuronal protein expression.", "journal": "Cell", "date": "2007", "authors": "Giorgi C, Yeo GW, Stone ME, Katz DB, Burge C, Turrigiano G, Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17632064", "url": "https://glygen.org/publication/PubMed/17632064" } ] }, { "title": "The AP-1 transcription factor regulates breast cancer cell growth via cyclins and E2F factors.", "journal": "Oncogene", "date": "2008", "authors": "Shen Q, Uray IP, Li Y, Krisko TI, Strecker TE, Kim HT, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17637753", "url": "https://glygen.org/publication/PubMed/17637753" } ] }, { "title": "Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Sun J, Nawaz Z, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17666587", "url": "https://glygen.org/publication/PubMed/17666587" } ] }, { "title": "Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Drabsch Y, Hugo H, Zhang R, Dowhan DH, Miao YR, Gewirtz AM, Barry SC, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17690249", "url": "https://glygen.org/publication/PubMed/17690249" } ] }, { "title": "Sustained Arc/Arg3.1 synthesis controls long-term potentiation consolidation through regulation of local actin polymerization in the dentate gyrus in vivo.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2007", "authors": "Messaoudi E, Kanhema T, Soule J, Tiron A, Dagyte G, da Silva B, Bramham CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17898216", "url": "https://glygen.org/publication/PubMed/17898216" } ] }, { "title": "Rad GTPase deficiency leads to cardiac hypertrophy.", "journal": "Circulation", "date": "2007", "authors": "Chang L, Zhang J, Tseng YH, Xie CQ, Ilany J, Bruning JC, Sun Z, Zhu X, Cui T, Youker KA, Yang Q, Day SM, Kahn CR, Chen YE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18056528", "url": "https://glygen.org/publication/PubMed/18056528" } ] }, { "title": "Serum- and glucocorticoid-inducible kinase 1 enhances zif268 expression through the mediation of SRF and CREB1 associated with spatial memory formation.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Tyan SW, Tsai MC, Lin CL, Ma YL, Lee EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18088355", "url": "https://glygen.org/publication/PubMed/18088355" } ] }, { "title": "Lyl1 interacts with CREB1 and alters expression of CREB1 target genes.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "San-Marina S, Han Y, Suarez Saiz F, Trus MR, Minden MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18160048", "url": "https://glygen.org/publication/PubMed/18160048" } ] }, { "title": "DNA oxidation as triggered by H3K9me2 demethylation drives estrogen-induced gene expression.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Perillo B, Ombra MN, Bertoni A, Cuozzo C, Sacchetti S, Sasso A, Chiariotti L, Malorni A, Abbondanza C, Avvedimento EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18187655", "url": "https://glygen.org/publication/PubMed/18187655" } ] }, { "title": "Cohesins localize with CTCF at the KSHV latency control region and at cellular c-myc and H19/Igf2 insulators.", "journal": "The EMBO journal", "date": "2008", "authors": "Stedman W, Kang H, Lin S, Kissil JL, Bartolomei MS, Lieberman PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18219272", "url": "https://glygen.org/publication/PubMed/18219272" } ] }, { "title": "Genome-wide mapping and characterization of hypomethylated sites in human tissues and breast cancer cell lines.", "journal": "Genome research", "date": "2008", "authors": "Shann YJ, Cheng C, Chiao CH, Chen DT, Li PH, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18256232", "url": "https://glygen.org/publication/PubMed/18256232" } ] }, { "title": "Transient cyclical methylation of promoter DNA.", "journal": "Nature", "date": "2008", "authors": "Kangaspeska S, Stride B, Metivier R, Polycarpou-Schwarz M, Ibberson D, Carmouche RP, Benes V, Gannon F, Reid G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18322535", "url": "https://glygen.org/publication/PubMed/18322535" } ] }, { "title": "Transactivation of Krox-20 and Krox-24 promoters by the HTLV-1 Tax protein through common regulatory elements.", "journal": "Oncogene", "date": "1991", "authors": "Alexandre C, Charnay P, Verrier B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1833716", "url": "https://glygen.org/publication/PubMed/1833716" } ] }, { "title": "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.", "journal": "Cell", "date": "2008", "authors": "Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18358809", "url": "https://glygen.org/publication/PubMed/18358809" } ] }, { "title": "Active gene repression by the Egr2.NAB complex during peripheral nerve myelination.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Mager GM, Ward RM, Srinivasan R, Jang SW, Wrabetz L, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18456662", "url": "https://glygen.org/publication/PubMed/18456662" } ] }, { "title": "Estrogen and MYB in breast cancer: potential for new therapies.", "journal": "Expert opinion on biological therapy", "date": "2008", "authors": "Gonda TJ, Leo P, Ramsay RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18476782", "url": "https://glygen.org/publication/PubMed/18476782" } ] }, { "title": "Disruption of Krox20-Nab interaction in the mouse leads to peripheral neuropathy with biphasic evolution.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2008", "authors": "Desmazieres A, Decker L, Vallat JM, Charnay P, Gilardi-Hebenstreit P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18524893", "url": "https://glygen.org/publication/PubMed/18524893" } ] }, { "title": "Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.", "journal": "Molecular cancer", "date": "2008", "authors": "Wilson BJ, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18533032", "url": "https://glygen.org/publication/PubMed/18533032" } ] }, { "title": "Nucleotide sequence and regulatory studies of VGF, a nervous system-specific mRNA that is rapidly and relatively selectively induced by nerve growth factor.", "journal": "Journal of neurochemistry", "date": "1991", "authors": "Salton SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1861162", "url": "https://glygen.org/publication/PubMed/1861162" } ] }, { "title": "Cathepsin D: a cellular roadmap.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zaidi N, Maurer A, Nieke S, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18762174", "url": "https://glygen.org/publication/PubMed/18762174" } ] }, { "title": "Marking time: the dynamic role of chromatin and covalent modification in transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Reid G, Gallais R, Metivier R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18805503", "url": "https://glygen.org/publication/PubMed/18805503" } ] }, { "title": "CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Andersson T, Sodersten E, Duckworth JK, Cascante A, Fritz N, Sacchetti P, Cervenka I, Bryja V, Hermanson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19001364", "url": "https://glygen.org/publication/PubMed/19001364" } ] }, { "title": "Transcriptional regulation of the cyclin D1 gene at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Klein EA, Assoian RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19020303", "url": "https://glygen.org/publication/PubMed/19020303" } ] }, { "title": "CDYL bridges REST and histone methyltransferases for gene repression and suppression of cellular transformation.", "journal": "Molecular cell", "date": "2008", "authors": "Mulligan P, Westbrook TF, Ottinger M, Pavlova N, Chang B, Macia E, Shi YJ, Barretina J, Liu J, Howley PM, Elledge SJ, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19061646", "url": "https://glygen.org/publication/PubMed/19061646" } ] }, { "title": "The lysine demethylase LSD1 (KDM1) is required for maintenance of global DNA methylation.", "journal": "Nature genetics", "date": "2009", "authors": "Wang J, Hevi S, Kurash JK, Lei H, Gay F, Bajko J, Su H, Sun W, Chang H, Xu G, Gaudet F, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19098913", "url": "https://glygen.org/publication/PubMed/19098913" } ] }, { "title": "Synaptic activity-responsive element in the Arc/Arg3.1 promoter essential for synapse-to-nucleus signaling in activated neurons.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Kawashima T, Okuno H, Nonaka M, Adachi-Morishima A, Kyo N, Okamura M, Takemoto-Kimura S, Worley PF, Bito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19116276", "url": "https://glygen.org/publication/PubMed/19116276" } ] }, { "title": "The serum response factor and a putative novel transcription factor regulate expression of the immediate-early gene Arc/Arg3.1 in neurons.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Pintchovski SA, Peebles CL, Kim HJ, Verdin E, Finkbeiner S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19193899", "url": "https://glygen.org/publication/PubMed/19193899" } ] }, { "title": "Neuroendocrine regulatory peptide-1 and -2: novel bioactive peptides processed from VGF.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2009", "authors": "Toshinai K, Nakazato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19194657", "url": "https://glygen.org/publication/PubMed/19194657" } ] }, { "title": "Breast cancer, estrogen receptor and ligands.", "journal": "Archiv der Pharmazie", "date": "2009", "authors": "Bai Z, Gust R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19274700", "url": "https://glygen.org/publication/PubMed/19274700" } ] }, { "title": "Histone modifications at human enhancers reflect global cell-type-specific gene expression.", "journal": "Nature", "date": "2009", "authors": "Heintzman ND, Hon GC, Hawkins RD, Kheradpour P, Stark A, Harp LF, Ye Z, Lee LK, Stuart RK, Ching CW, Ching KA, Antosiewicz-Bourget JE, Liu H, Zhang X, Green RD, Lobanenkov VV, Stewart R, Thomson JA, Crawford GE, Kellis M, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19295514", "url": "https://glygen.org/publication/PubMed/19295514" } ] }, { "title": "Genomic responses from the estrogen-responsive element-dependent signaling pathway mediated by estrogen receptor alpha are required to elicit cellular alterations.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nott SL, Huang Y, Li X, Fluharty BR, Qiu X, Welshons WV, Yeh S, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19321454", "url": "https://glygen.org/publication/PubMed/19321454" } ] }, { "title": "E2-mediated cathepsin D (CTSD) activation involves looping of distal enhancer elements.", "journal": "Molecular oncology", "date": "2008", "authors": "Bretschneider N, Kangaspeska S, Seifert M, Reid G, Gannon F, Denger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19383337", "url": "https://glygen.org/publication/PubMed/19383337" } ] }, { "title": "The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.", "journal": "Oncogene", "date": "2009", "authors": "Wortham NC, Ahamed E, Nicol SM, Thomas RS, Periyasamy M, Jiang J, Ochocka AM, Shousha S, Huson L, Bray SE, Coombes RC, Ali S, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19718048", "url": "https://glygen.org/publication/PubMed/19718048" } ] }, { "title": "Rad as a novel regulator of excitation-contraction coupling and beta-adrenergic signaling in heart.", "journal": "Circulation research", "date": "2010", "authors": "Wang G, Zhu X, Xie W, Han P, Li K, Sun Z, Wang Y, Chen C, Song R, Cao C, Zhang J, Wu C, Liu J, Cheng H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19926875", "url": "https://glygen.org/publication/PubMed/19926875" } ] }, { "title": "Structure of the gene encoding VGF, a nervous system-specific mRNA that is rapidly and selectively induced by nerve growth factor in PC12 cells.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Salton SR, Fischberg DJ, Dong KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2017159", "url": "https://glygen.org/publication/PubMed/2017159" } ] }, { "title": "A CTCF-independent role for cohesin in tissue-specific transcription.", "journal": "Genome research", "date": "2010", "authors": "Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20219941", "url": "https://glygen.org/publication/PubMed/20219941" } ] }, { "title": "A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim MS, Yoon SK, Bollig F, Kitagaki J, Hur W, Whye NJ, Wu YP, Rivera MN, Park JY, Kim HS, Malik K, Bell DW, Englert C, Perantoni AO, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20220130", "url": "https://glygen.org/publication/PubMed/20220130" } ] }, { "title": "v-Src activates mitogen-responsive transcription factor Egr-1 via serum response elements.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Qureshi SA, Cao XM, Sukhatme VP, Foster DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2040600", "url": "https://glygen.org/publication/PubMed/2040600" } ] }, { "title": "DeltaFosB in brain reward circuits mediates resilience to stress and antidepressant responses.", "journal": "Nat. Neurosci.", "date": "2010", "authors": "Neve R.L., Krishnan V., Wallace D.L., Vialou V., Nestler E.J., Tamminga C.A., Robison A.J., Berton O., Dietz D.M., Bolanos C.A., Covington H.E. III, Ghose S., Iniguez S.D., Laplant Q.C., Mouzon E., Ohnishi Y.H., Ohnishi Y.N., Rush A.J. III, Steiner M.A., Warren B.L., Watts E.L.", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "reference": [ { "type": "PubMed", "id": "20473292", "url": "https://glygen.org/publication/PubMed/20473292" } ] }, { "title": "Novel trans-tail regulation of H2B ubiquitylation and H3K4 methylation by the N terminus of histone H2A.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Zheng S, Wyrick JJ, Reese JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20498280", "url": "https://glygen.org/publication/PubMed/20498280" } ] }, { "title": "EGR1, EGR2, and EGR3 activate the expression of their coregulator NAB2 establishing a negative feedback loop in cells of neuroectodermal and epithelial origin.", "journal": "Journal of cellular biochemistry", "date": "2010", "authors": "Kumbrink J, Kirsch KH, Johnson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "20506119", "url": "https://glygen.org/publication/PubMed/20506119" } ] }, { "title": "5' upstream sequence and genomic structure of the human primary response gene, EGR-1/TIS8.", "journal": "Oncogene", "date": "1991", "authors": "Sakamoto KM, Bardeleben C, Yates KE, Raines MA, Golde DW, Gasson JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2052361", "url": "https://glygen.org/publication/PubMed/2052361" } ] }, { "title": "Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Wolf J, Reimer TA, Schuck S, Ruder C, Gerlach K, Muller EC, Otto A, Dorken B, Rehm A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20570965", "url": "https://glygen.org/publication/PubMed/20570965" } ] }, { "title": "The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.", "journal": "Cancer research", "date": "2010", "authors": "Yang J, Jubb AM, Pike L, Buffa FM, Turley H, Baban D, Leek R, Gatter KC, Ragoussis J, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20682797", "url": "https://glygen.org/publication/PubMed/20682797" } ] }, { "title": "The early response gene NGFI-C encodes a zinc finger transcriptional activator and is a member of the GCGGGGGCG (GSG) element-binding protein family.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Crosby SD, Puetz JJ, Simburger KS, Fahrner TJ, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2072895", "url": "https://glygen.org/publication/PubMed/2072895" } ] }, { "title": "Synaptic activity-responsive element (SARE): A unique genomic structure with an unusual sensitivity to neuronal activity.", "journal": "Communicative & integrative biology", "date": "2010", "authors": "Inoue M, Yagishita-Kyo N, Nonaka M, Kawashima T, Okuno H, Bito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21057636", "url": "https://glygen.org/publication/PubMed/21057636" } ] }, { "title": "Identification and characterization of the Egr-1 gene product, a DNA-binding zinc finger protein induced by differentiation and growth signals.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Cao XM, Koski RA, Gashler A, McKiernan M, Morris CF, Gaffney R, Hay RV, Sukhatme VP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2109185", "url": "https://glygen.org/publication/PubMed/2109185" } ] }, { "title": "Histone H3K27ac separates active from poised enhancers and predicts developmental state.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Creyghton MP, Cheng AW, Welstead GG, Kooistra T, Carey BW, Steine EJ, Hanna J, Lodato MA, Frampton GM, Sharp PA, Boyer LA, Young RA, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21106759", "url": "https://glygen.org/publication/PubMed/21106759" } ] }, { "title": "FOXA1 is a key determinant of estrogen receptor function and endocrine response.", "journal": "Nature genetics", "date": "2011", "authors": "Hurtado A, Holmes KA, Ross-Innes CS, Schmidt D, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21151129", "url": "https://glygen.org/publication/PubMed/21151129" } ] }, { "title": "Activation and function of immediate-early genes in the nervous system.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2011", "authors": "Perez-Cadahia B, Drobic B, Davie JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21326363", "url": "https://glygen.org/publication/PubMed/21326363" } ] }, { "title": "Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.", "journal": "PloS one", "date": "2011", "authors": "Kawazu M, Saso K, Tong KI, McQuire T, Goto K, Son DO, Wakeham A, Miyagishi M, Mak TW, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21445275", "url": "https://glygen.org/publication/PubMed/21445275" } ] }, { "title": "ID1 and ID3 represent conserved negative regulators of human embryonic and induced pluripotent stem cell hematopoiesis.", "journal": "Journal of cell science", "date": "2011", "authors": "Hong SH, Lee JH, Lee JB, Ji J, Bhatia M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21486943", "url": "https://glygen.org/publication/PubMed/21486943" } ] }, { "title": "Intracellular estrogen receptor-binding fragment-associated antigen 9 exerts in vivo tumor-promoting effects via its coiled-coil region.", "journal": "International journal of oncology", "date": "2011", "authors": "Maeyama Y, Otsu M, Kubo S, Yamano T, Iimura Y, Onodera M, Kondo S, Sakiyama Y, Ariga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21573489", "url": "https://glygen.org/publication/PubMed/21573489" } ] }, { "title": "VGF: an inducible gene product, precursor of a diverse array of neuro-endocrine peptides and tissue-specific disease biomarkers.", "journal": "Journal of chemical neuroanatomy", "date": "2011", "authors": "Ferri GL, Noli B, Brancia C, D'Amato F, Cocco C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21621608", "url": "https://glygen.org/publication/PubMed/21621608" } ] }, { "title": "Strong association between c-myb and oestrogen-receptor expression in human breast cancer.", "journal": "Oncogene", "date": "1990", "authors": "Guerin M, Sheng ZM, Andrieu N, Riou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2181374", "url": "https://glygen.org/publication/PubMed/2181374" } ] }, { "title": "Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Wang C, Mayer JA, Mazumdar A, Fertuck K, Kim H, Brown M, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21835891", "url": "https://glygen.org/publication/PubMed/21835891" } ] }, { "title": "Cellular reprogramming by the conjoint action of ERalpha, FOXA1, and GATA3 to a ligand-inducible growth state.", "journal": "Molecular systems biology", "date": "2011", "authors": "Kong SL, Li G, Loh SL, Sung WK, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21878914", "url": "https://glygen.org/publication/PubMed/21878914" } ] }, { "title": "FOXA1: master of steroid receptor function in cancer.", "journal": "The EMBO journal", "date": "2011", "authors": "Augello MA, Hickey TE, Knudsen KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21934649", "url": "https://glygen.org/publication/PubMed/21934649" } ] }, { "title": "Gene regulation by cohesin in cancer: is the ring an unexpected party to proliferation?", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Rhodes JM, McEwan M, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21940756", "url": "https://glygen.org/publication/PubMed/21940756" } ] }, { "title": "Early growth response 1--a transcription factor in the crossfire of signal transduction cascades.", "journal": "Indian journal of biochemistry & biophysics", "date": "2011", "authors": "Pagel JI, Deindl E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "22053691", "url": "https://glygen.org/publication/PubMed/22053691" } ] }, { "title": "Pioneer transcription factors: establishing competence for gene expression.", "journal": "Genes & development", "date": "2011", "authors": "Zaret KS, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22056668", "url": "https://glygen.org/publication/PubMed/22056668" } ] }, { "title": "Global expression analysis identified a preferentially nerve growth factor-induced transcriptional program regulated by sustained mitogen-activated protein kinase/extracellular signal-regulated kinase (ERK) and AP-1 protein activation during PC12 cell differentiation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mullenbrock S, Shah J, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "22065583", "url": "https://glygen.org/publication/PubMed/22065583" } ] }, { "title": "Extensive promoter-centered chromatin interactions provide a topological basis for transcription regulation.", "journal": "Cell", "date": "2012", "authors": "Li G, Ruan X, Auerbach RK, Sandhu KS, Zheng M, Wang P, Poh HM, Goh Y, Lim J, Zhang J, Sim HS, Peh SQ, Mulawadi FH, Ong CT, Orlov YL, Hong S, Zhang Z, Landt S, Raha D, Euskirchen G, Wei CL, Ge W, Wang H, Davis C, Fisher-Aylor KI, Mortazavi A, Gerstein M, Gingeras T, Wold B, Sun Y, Fullwood MJ, Cheung E, Liu E, Sung WK, Snyder M, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22265404", "url": "https://glygen.org/publication/PubMed/22265404" } ] }, { "title": "The nucleosome remodeling and deacetylase chromatin remodeling (NuRD) complex is required for peripheral nerve myelination.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2012", "authors": "Hung H, Kohnken R, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "22302795", "url": "https://glygen.org/publication/PubMed/22302795" } ] }, { "title": "Localization of human tissue factor antigen by immunostaining with monospecific, polyclonal anti-human tissue factor antibody.", "journal": "Thrombosis research", "date": "1990", "authors": "Fleck RA, Rao LV, Rapaport SI, Varki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2237820", "url": "https://glygen.org/publication/PubMed/2237820" } ] }, { "title": "Estrogen receptor-alpha recruits P-TEFb to overcome transcriptional pausing in intron 1 of the MYB gene.", "journal": "Nucleic acids research", "date": "2012", "authors": "Mitra P, Pereira LA, Drabsch Y, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22492511", "url": "https://glygen.org/publication/PubMed/22492511" } ] }, { "title": "Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.", "journal": "PloS one", "date": "2012", "authors": "Clarke CL, Graham JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22545144", "url": "https://glygen.org/publication/PubMed/22545144" } ] }, { "title": "The elements of human cyclin D1 promoter and regulation involved.", "journal": "Clinical epigenetics", "date": "2011", "authors": "Guo ZY, Hao XH, Tan FF, Pei X, Shang LM, Jiang XL, Yang F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22704330", "url": "https://glygen.org/publication/PubMed/22704330" } ] }, { "title": "Cohesin is required for activation of MYC by estradiol.", "journal": "PloS one", "date": "2012", "authors": "McEwan MV, Eccles MR, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23145106", "url": "https://glygen.org/publication/PubMed/23145106" } ] }, { "title": "GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.", "journal": "Genome research", "date": "2013", "authors": "Theodorou V, Stark R, Menon S, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23172872", "url": "https://glygen.org/publication/PubMed/23172872" } ] }, { "title": "Cooperating transcription factors mediate the function of estrogen receptor.", "journal": "Chromosoma", "date": "2013", "authors": "Fiorito E, Katika MR, Hurtado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23192763", "url": "https://glygen.org/publication/PubMed/23192763" } ] }, { "title": "Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.", "journal": "Nucleic acids research", "date": "2013", "authors": "Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23303788", "url": "https://glygen.org/publication/PubMed/23303788" } ] }, { "title": "Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.", "journal": "Cell reports", "date": "2013", "authors": "Mohammed H, D'Santos C, Serandour AA, Ali HR, Brown GD, Atkins A, Rueda OM, Holmes KA, Theodorou V, Robinson JL, Zwart W, Saadi A, Ross-Innes CS, Chin SF, Menon S, Stingl J, Palmieri C, Caldas C, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23403292", "url": "https://glygen.org/publication/PubMed/23403292" } ] }, { "title": "The lysine demethylase, KDM4B, is a key molecule in androgen receptor signalling and turnover.", "journal": "Nucleic acids research", "date": "2013", "authors": "Coffey K, Rogerson L, Ryan-Munden C, Alkharaif D, Stockley J, Heer R, Sahadevan K, O'Neill D, Jones D, Darby S, Staller P, Mantilla A, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23435229", "url": "https://glygen.org/publication/PubMed/23435229" } ] }, { "title": "KDM4B is a master regulator of the estrogen receptor signalling cascade.", "journal": "Nucleic acids research", "date": "2013", "authors": "Gaughan L, Stockley J, Coffey K, O'Neill D, Jones DL, Wade M, Wright J, Moore M, Tse S, Rogerson L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23723241", "url": "https://glygen.org/publication/PubMed/23723241" } ] }, { "title": "CXXC5 Associates with Smads to Mediate TNF-alpha Induced Apoptosis.", "journal": "Current molecular medicine", "date": "2013", "authors": "Wang X, Liao P, Fan X, Wan Y, Wang Y, Li Y, Jiang Z, Ye X, Mo X, Ocorr K, Deng Y, Wu X, Yuan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23906331", "url": "https://glygen.org/publication/PubMed/23906331" } ] }, { "title": "Identification of a functional TPH1 polymorphism associated with irritable bowel syndrome bowel habit subtypes.", "journal": "The American journal of gastroenterology", "date": "2013", "authors": "Grasberger H, Chang L, Shih W, Presson AP, Sayuk GS, Newberry RD, Karagiannides I, Pothoulakis C, Mayer E, Merchant JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "24060757", "url": "https://glygen.org/publication/PubMed/24060757" } ] }, { "title": "Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.", "journal": "Disease markers", "date": "2013", "authors": "Giaginis C, Efkarpidis T, Alexandrou P, Patsouris E, Kouraklis G, Theocharis S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24167369", "url": "https://glygen.org/publication/PubMed/24167369" } ] }, { "title": "An H2A histone isotype regulates estrogen receptor target genes by mediating enhancer-promoter-3'-UTR interactions in breast cancer cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Su CH, Tzeng TY, Cheng C, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24371278", "url": "https://glygen.org/publication/PubMed/24371278" } ] }, { "title": "Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Tan S, Ding K, Li R, Zhang W, Li G, Kong X, Qian P, Lobie PE, Zhu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24735615", "url": "https://glygen.org/publication/PubMed/24735615" } ] }, { "title": "Cohesin in cancer: chromosome segregation and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Losada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24854081", "url": "https://glygen.org/publication/PubMed/24854081" } ] }, { "title": "Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2014", "authors": "Tanaka H, Toyoshima T, Sonoda K, Kitamura R, Sasaguri M, Kawano S, Matsubara R, Goto Y, Nakamura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24885040", "url": "https://glygen.org/publication/PubMed/24885040" } ] }, { "title": "A functional interplay between ZNF217 and estrogen receptor alpha exists in luminal breast cancers.", "journal": "Molecular oncology", "date": "2014", "authors": "Nguyen NT, Vendrell JA, Poulard C, Gyorffy B, Goddard-Leon S, Bieche I, Corbo L, Le Romancer M, Bachelot T, Treilleux I, Cohen PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24973012", "url": "https://glygen.org/publication/PubMed/24973012" } ] }, { "title": "Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.", "journal": "Expert opinion on therapeutic targets", "date": "2014", "authors": "Hodgkinson KM, Vanderhyden BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24998469", "url": "https://glygen.org/publication/PubMed/24998469" } ] }, { "title": "Id proteins: small molecules, mighty regulators.", "journal": "Current topics in developmental biology", "date": "2014", "authors": "Ling F, Kang B, Sun XH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "25248477", "url": "https://glygen.org/publication/PubMed/25248477" } ] }, { "title": "Serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a diagnostic and prognostic marker for non-small cell lung cancer.", "journal": "Tumori", "date": "2014", "authors": "Xu C, Yu LK, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25296600", "url": "https://glygen.org/publication/PubMed/25296600" } ] }, { "title": "EBAG9 modulates host immune defense against tumor formation and metastasis by regulating cytotoxic activity of T lymphocytes.", "journal": "Oncogenesis", "date": "2014", "authors": "Miyazaki T, Ikeda K, Horie-Inoue K, Kondo T, Takahashi S, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25365482", "url": "https://glygen.org/publication/PubMed/25365482" } ] }, { "title": "CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.", "journal": "Journal of muscle research and cell motility", "date": "2014", "authors": "Li G, Ye X, Peng X, Deng Y, Yuan W, Li Y, Mo X, Wang X, Wan Y, Liu X, Chen T, Jiang Z, Fan X, Wu X, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25433557", "url": "https://glygen.org/publication/PubMed/25433557" } ] }, { "title": "Cohesin modulates transcription of estrogen-responsive genes.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Antony J, Dasgupta T, Rhodes JM, McEwan MV, Print CG, O'Sullivan JM, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25542856", "url": "https://glygen.org/publication/PubMed/25542856" } ] }, { "title": "Transcriptional regulation of the neuropeptide VGF by the neuron-restrictive silencer factor/neuron-restrictive silencer element.", "journal": "Neuroreport", "date": "2015", "authors": "Moon SM, Kim JS, Park BR, Kim DK, Kim SG, Kim HJ, Chun HS, Lee BK, Kim CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "25569790", "url": "https://glygen.org/publication/PubMed/25569790" } ] }, { "title": "CXXC5 is a negative-feedback regulator of the Wnt/beta-catenin pathway involved in osteoblast differentiation.", "journal": "Cell death and differentiation", "date": "2015", "authors": "Kim HY, Yoon JY, Yun JH, Cho KW, Lee SH, Rhee YM, Jung HS, Lim HJ, Lee H, Choi J, Heo JN, Lee W, No KT, Min D, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25633194", "url": "https://glygen.org/publication/PubMed/25633194" } ] }, { "title": "Two Faces of Cathepsin D: Physiological Guardian Angel and Pathological Demon.", "journal": "Biology and medicine (Aligarh)", "date": "2014", "authors": "Khalkhali-Ellis Z, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25663755", "url": "https://glygen.org/publication/PubMed/25663755" } ] }, { "title": "Expression of RCAS1 correlates with urothelial bladder cancer malignancy.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Jozwicki W, Brozyna AA, Siekiera J, Slominski AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25674852", "url": "https://glygen.org/publication/PubMed/25674852" } ] }, { "title": "Structure of a biologically active estrogen receptor-coactivator complex on DNA.", "journal": "Molecular cell", "date": "2015", "authors": "Yi P, Wang Z, Feng Q, Pintilie GD, Foulds CE, Lanz RB, Ludtke SJ, Schmid MF, Chiu W, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25728767", "url": "https://glygen.org/publication/PubMed/25728767" } ] }, { "title": "Arc is a flexible modular protein capable of reversible self-oligomerization.", "journal": "The Biochemical journal", "date": "2015", "authors": "Myrum C, Baumann A, Bustad HJ, Flydal MI, Mariaule V, Alvira S, Cuellar J, Haavik J, Soule J, Valpuesta JM, Marquez JA, Martinez A, Bramham CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "25748042", "url": "https://glygen.org/publication/PubMed/25748042" } ] }, { "title": "How it all starts: Initiation of the clotting cascade.", "journal": "Critical reviews in biochemistry and molecular biology", "date": "2015", "authors": "Smith SA, Travers RJ, Morrissey JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "26018600", "url": "https://glygen.org/publication/PubMed/26018600" } ] }, { "title": "The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Lee SH, Kim MY, Kim HY, Lee YM, Kim H, Nam KA, Roh MR, Min do S, Chung KY, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26056233", "url": "https://glygen.org/publication/PubMed/26056233" } ] }, { "title": "Progesterone receptor modulates ERalpha action in breast cancer.", "journal": "Nature", "date": "2015", "authors": "Mohammed H, Russell IA, Stark R, Rueda OM, Hickey TE, Tarulli GA, Serandour AA, Birrell SN, Bruna A, Saadi A, Menon S, Hadfield J, Pugh M, Raj GV, Brown GD, D'Santos C, Robinson JL, Silva G, Launchbury R, Perou CM, Stingl J, Caldas C, Tilley WD, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26153859", "url": "https://glygen.org/publication/PubMed/26153859" } ] }, { "title": "MiR-26b/KPNA2 axis inhibits epithelial ovarian carcinoma proliferation and metastasis through downregulating OCT4.", "journal": "Oncotarget", "date": "2015", "authors": "Lin J, Zhang L, Huang H, Huang Y, Huang L, Wang J, Huang S, He L, Zhou Y, Jia W, Yun J, Luo R, Zheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26204489", "url": "https://glygen.org/publication/PubMed/26204489" } ] }, { "title": "CXXC5 plays a role as a transcription activator for myelin genes on oligodendrocyte differentiation.", "journal": "Glia", "date": "2016", "authors": "Kim MY, Kim HY, Hong J, Kim D, Lee H, Cheong E, Lee Y, Roth J, Kim DG, Min do S, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26462610", "url": "https://glygen.org/publication/PubMed/26462610" } ] }, { "title": "Trefoil factor family peptides--friends or foes?", "journal": "Biomolecular concepts", "date": "2015", "authors": "Busch M, Dunker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26479350", "url": "https://glygen.org/publication/PubMed/26479350" } ] }, { "title": "A protein induced by NGF in PC12 cells is stored in secretory vesicles and released through the regulated pathway.", "journal": "The EMBO journal", "date": "1989", "authors": "Possenti R, Eldridge JD, Paterson BM, Grasso A, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2676516", "url": "https://glygen.org/publication/PubMed/2676516" } ] }, { "title": "Structural Basis for Substrate Selectivity of the E3 Ligase COP1.", "journal": "Structure (London, England : 1993)", "date": "2016", "authors": "Uljon S, Xu X, Durzynska I, Stein S, Adelmant G, Marto JA, Pear WS, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "27041596", "url": "https://glygen.org/publication/PubMed/27041596" } ] }, { "title": "Steroid Receptors Reprogram FoxA1 Occupancy through Dynamic Chromatin Transitions.", "journal": "Cell", "date": "2016", "authors": "Swinstead EE, Miranda TB, Paakinaho V, Baek S, Goldstein I, Hawkins M, Karpova TS, Ball D, Mazza D, Lavis LD, Grimm JB, Morisaki T, Grontved L, Presman DM, Hager GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27062924", "url": "https://glygen.org/publication/PubMed/27062924" } ] }, { "title": "Combined Id1 and Id3 Deletion Leads to Severe Erythropoietic Disturbances.", "journal": "PloS one", "date": "2016", "authors": "Zhao Q, Chang C, Gonzalez JP, Alzahrani K, Button JL, Fraidenraich D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "27128622", "url": "https://glygen.org/publication/PubMed/27128622" } ] }, { "title": "Gene regulation in the immediate-early response process.", "journal": "Advances in biological regulation", "date": "2016", "authors": "Bahrami S, Drablos F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "27220739", "url": "https://glygen.org/publication/PubMed/27220739" } ] }, { "title": "Estradiol-Estrogen Receptor alpha Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway.", "journal": "Scientific reports", "date": "2016", "authors": "Yasar P, Ayaz G, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27886276", "url": "https://glygen.org/publication/PubMed/27886276" } ] }, { "title": "Role for Egr1 in the Transcriptional Program Associated with Neuronal Differentiation of PC12 Cells.", "journal": "PloS one", "date": "2017", "authors": "Adams KW, Kletsov S, Lamm RJ, Elman JS, Mullenbrock S, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "28076410", "url": "https://glygen.org/publication/PubMed/28076410" } ] }, { "title": "Binding and inhibition of the ternary complex factor Elk-4/Sap1 by the adapter protein Dok-4.", "journal": "The Biochemical journal", "date": "2017", "authors": "Hooker E, Baldwin C, Roodman V, Batra A, Isa NN, Takano T, Lemay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "28275114", "url": "https://glygen.org/publication/PubMed/28275114" } ] }, { "title": "ERK-Induced Activation of TCF Family of SRF Cofactors Initiates a Chromatin Modification Cascade Associated with Transcription.", "journal": "Molecular cell", "date": "2017", "authors": "Esnault C, Gualdrini F, Horswell S, Kelly G, Stewart A, East P, Matthews N, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "28286024", "url": "https://glygen.org/publication/PubMed/28286024" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "Activator Protein-1: redox switch controlling structure and DNA-binding.", "journal": "Nucleic Acids Res.", "date": "2017", "authors": "Yin Z, Machius M, Nestler EJ, Rudenko G", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "reference": [ { "type": "PubMed", "id": "28981703", "url": "https://glygen.org/publication/PubMed/28981703" } ] }, { "title": "Estrogen-responsive element of the human pS2 gene is an imperfectly palindromic sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Berry M, Nunez AM, Chambon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2919170", "url": "https://glygen.org/publication/PubMed/2919170" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P53539", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P53539" }, { "database": "O-GlcNAc Atlas", "id": "P53539", "url": "https://oglcnac.org/atlas/detail/P53539" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "The Arc of cognition: Signaling cascades regulating Arc and implications for cognitive function and disease.", "journal": "Seminars in cell & developmental biology", "date": "2018", "authors": "Epstein I, Finkbeiner S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "29559111", "url": "https://glygen.org/publication/PubMed/29559111" } ] }, { "title": "Transcriptional regulation of c-myc oncogene expression by estrogen in hormone-responsive human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3045126", "url": "https://glygen.org/publication/PubMed/3045126" } ] }, { "title": "A zinc finger-encoding gene coregulated with c-fos during growth and differentiation, and after cellular depolarization.", "journal": "Cell", "date": "1988", "authors": "Sukhatme VP, Cao XM, Chang LC, Tsai-Morris CH, Stamenkovich D, Ferreira PC, Cohen DR, Edwards SA, Shows TB, Curran T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "3127059", "url": "https://glygen.org/publication/PubMed/3127059" } ] }, { "title": "Self-assembly of the bZIP transcription factor FosB.", "journal": "Curr. Res. Struct. Biol.", "date": "2020", "authors": "Machius M., Yin Z., Lynch H., Rudenko G., Nestler E.J., Robison A.J., Aglyamova G., Bhandari M., Venkannagari H.", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "reference": [ { "type": "PubMed", "id": "32542236", "url": "https://glygen.org/publication/PubMed/32542236" } ] }, { "title": "A transcriptional arrest mechanism involved in controlling constitutive levels of mouse c-myb mRNA.", "journal": "Oncogene", "date": "1988", "authors": "Watson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3281094", "url": "https://glygen.org/publication/PubMed/3281094" } ] }, { "title": "Knockout of FosB gene changes drug sensitivity and invasion activity via the regulation of Bcl-2, E-cadherin, beta-catenin, and vimentin expression.", "journal": "Biochemical and biophysical research communications", "date": "2021", "authors": "Na HH, Ryu JM, Kim KC", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" } ], "reference": [ { "type": "PubMed", "id": "34153682", "url": "https://glygen.org/publication/PubMed/34153682" } ] }, { "title": "Differential expression of c-myb mRNA in murine B lymphomas by a block to transcription elongation.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Bender TP, Thompson CB, Kuehl WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3498214", "url": "https://glygen.org/publication/PubMed/3498214" } ] }, { "title": "Identifying DUSP-1 and FOSB as hub genes in immunoglobulin A nephropathy by WGCNA and DEG screening and validation.", "journal": "PeerJ", "date": "2022", "authors": "Jianping Wu, Wei Xiaona, Li Jiajia, Zhang Rui, Han Qianqian, Yang Qiongqiong", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" } ], "reference": [ { "type": "PubMed", "id": "35910761", "url": "https://glygen.org/publication/PubMed/35910761" } ] }, { "title": "[The Prognostic Value of FOSB Gene in Acute Myeloid Leukemia].", "journal": "Zhongguo shi yan xue ye xue za zhi", "date": "2022", "authors": "Luan SH, Ma YQ, Yang JJ, Wang H, Liu DH, Dou LP", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" } ], "reference": [ { "type": "PubMed", "id": "35981363", "url": "https://glygen.org/publication/PubMed/35981363" } ] }, { "title": "Inflammatory lobular hemangioma (T-cell-rich angiomatoid polypoid pseudolymphoma)-Assessment of FOS/FOSB and lymphoid markers and comparison with epithelioid hemangioma.", "journal": "Journal of cutaneous pathology", "date": "2022-12", "authors": "Vargas Ana Cristina, Maclean Fiona M, Tsu Kwan Yee, Ma Leanne, Moir Denis", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" } ], "reference": [ { "type": "PubMed", "id": "36008878", "url": "https://glygen.org/publication/PubMed/36008878" } ] }, { "title": "A nerve growth factor-induced gene encodes a possible transcriptional regulatory factor.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "3672127", "url": "https://glygen.org/publication/PubMed/3672127" } ] }, { "title": "Stimulation of c-myc oncogene expression associated with estrogen-induced proliferation of human breast cancer cells.", "journal": "Cancer research", "date": "1987", "authors": "Dubik D, Dembinski TC, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3677090", "url": "https://glygen.org/publication/PubMed/3677090" } ] }, { "title": "Expression of SARS-CoV-2 receptor angiotensin-converting enzyme 2 by activating protein-1 in human mast cells.", "journal": "Cellular immunology", "date": "2023-04", "authors": "Kim Hee-Yun, Kang Ho-Geun, Kim Hyung-Min, Jeong Hyun-Ja", "evidence": [ { "database": "RefSeq", "id": "NP_001107643", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107643" } ], "reference": [ { "type": "PubMed", "id": "36898276", "url": "https://glygen.org/publication/PubMed/36898276" } ] }, { "title": "Serine 133-phosphorylated CREB induces transcription via a cooperative mechanism that may confer specificity to neurotrophin signals.", "journal": "Molecular and cellular neurosciences", "date": "1995", "authors": "Bonni A, Ginty DD, Dudek H, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7551568", "url": "https://glygen.org/publication/PubMed/7551568" } ] }, { "title": "Transforming p21ras mutants and c-Ets-2 activate the cyclin D1 promoter through distinguishable regions.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Albanese C, Johnson J, Watanabe G, Eklund N, Vu D, Arnold A, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7559524", "url": "https://glygen.org/publication/PubMed/7559524" } ] }, { "title": "An isoform of the neuronal cyclin-dependent kinase 5 (Cdk5) activator.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Tang D, Yeung J, Lee KY, Matsushita M, Matsui H, Tomizawa K, Hatase O, Wang JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7592934", "url": "https://glygen.org/publication/PubMed/7592934" } ] }, { "title": "Tissue-specific processing of the neuroendocrine protein VGF.", "journal": "Journal of neurochemistry", "date": "1995", "authors": "Trani E, Ciotti T, Rinaldi AM, Canu N, Ferri GL, Levi A, Possenti R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7595538", "url": "https://glygen.org/publication/PubMed/7595538" } ] }, { "title": "Transcriptional activation of egr-1 by granulocyte-macrophage colony-stimulating factor but not interleukin 3 requires phosphorylation of cAMP response element-binding protein (CREB) on serine 133.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Lee HJ, Mignacca RC, Sakamoto KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7608156", "url": "https://glygen.org/publication/PubMed/7608156" } ] }, { "title": "Identification of NAB1, a repressor of NGFI-A- and Krox20-mediated transcription.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Russo MW, Sevetson BR, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7624335", "url": "https://glygen.org/publication/PubMed/7624335" } ] }, { "title": "Somatodendritic expression of an immediate early gene is regulated by synaptic activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Link W, Konietzko U, Kauselmann G, Krug M, Schwanke B, Frey U, Kuhl D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7777577", "url": "https://glygen.org/publication/PubMed/7777577" } ] }, { "title": "A ternary complex factor-dependent mechanism mediates induction of egr-1 through selective serum response elements following antigen receptor cross-linking in B lymphocytes.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "McMahon SB, Monroe JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7823924", "url": "https://glygen.org/publication/PubMed/7823924" } ] }, { "title": "Arc, a growth factor and activity-regulated gene, encodes a novel cytoskeleton-associated protein that is enriched in neuronal dendrites.", "journal": "Neuron", "date": "1995", "authors": "Lyford GL, Yamagata K, Kaufmann WE, Barnes CA, Sanders LK, Copeland NG, Gilbert DJ, Jenkins NA, Lanahan AA, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7857651", "url": "https://glygen.org/publication/PubMed/7857651" } ] }, { "title": "The neuron-restrictive silencer factor (NRSF): a coordinate repressor of multiple neuron-specific genes.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Schoenherr CJ, Anderson DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7871435", "url": "https://glygen.org/publication/PubMed/7871435" } ] }, { "title": "Characterization of Rad, a new member of Ras/GTPase superfamily, and its regulation by a unique GTPase-activating protein (GAP)-like activity.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Zhu J, Reynet C, Caldwell JS, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7876254", "url": "https://glygen.org/publication/PubMed/7876254" } ] }, { "title": "Deficient long-term memory in mice with a targeted mutation of the cAMP-responsive element-binding protein.", "journal": "Cell", "date": "1994", "authors": "Bourtchuladze R, Frenguelli B, Blendy J, Cioffi D, Schutz G, Silva AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7923378", "url": "https://glygen.org/publication/PubMed/7923378" } ] }, { "title": "Characterization of the proximal estrogen-responsive element of human cathepsin D gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Augereau P, Miralles F, Cavailles V, Gaudelet C, Parker M, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7935485", "url": "https://glygen.org/publication/PubMed/7935485" } ] }, { "title": "Interaction of proteins with transcriptionally active estrogen receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Cavailles V, Dauvois S, Danielian PS, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7937828", "url": "https://glygen.org/publication/PubMed/7937828" } ] }, { "title": "p35 is a neural-specific regulatory subunit of cyclin-dependent kinase 5.", "journal": "Nature", "date": "1994", "authors": "Tsai LH, Delalle I, Caviness VS Jr, Chae T, Harlow E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8090221", "url": "https://glygen.org/publication/PubMed/8090221" } ] }, { "title": "A brain-specific activator of cyclin-dependent kinase 5.", "journal": "Nature", "date": "1994", "authors": "Lew J, Huang QQ, Qi Z, Winkfein RJ, Aebersold R, Hunt T, Wang JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8090222", "url": "https://glygen.org/publication/PubMed/8090222" } ] }, { "title": "Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Krishnan V, Wang X, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8195246", "url": "https://glygen.org/publication/PubMed/8195246" } ] }, { "title": "Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8197458", "url": "https://glygen.org/publication/PubMed/8197458" } ] }, { "title": "Rad: a member of the Ras family overexpressed in muscle of type II diabetic humans.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Reynet C, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8248782", "url": "https://glygen.org/publication/PubMed/8248782" } ] }, { "title": "Transcriptional activity of the zinc finger protein NGFI-A is influenced by its interaction with a cellular factor.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Russo MW, Matheny C, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8413279", "url": "https://glygen.org/publication/PubMed/8413279" } ] }, { "title": "Cathepsin D gene is controlled by a mixed promoter, and estrogens stimulate only TATA-dependent transcription in breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Cavailles V, Augereau P, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8419924", "url": "https://glygen.org/publication/PubMed/8419924" } ] }, { "title": "Nerve growth factor induces transcription of NGFIA through complex regulatory elements that are also sensitive to serum and phorbol 12-myristate 13-acetate.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1993", "authors": "DeFranco C, Damon DH, Endoh M, Wagner JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8483478", "url": "https://glygen.org/publication/PubMed/8483478" } ] }, { "title": "Transcriptional regulation of the tissue factor gene in human epithelial cells is mediated by Sp1 and EGR-1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Cui MZ, Parry GC, Oeth P, Larson H, Smith M, Huang RP, Adamson ED, Mackman N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8576248", "url": "https://glygen.org/publication/PubMed/8576248" } ] }, { "title": "Increased expression of early growth response-1 messenger ribonucleic acid in prostatic adenocarcinoma.", "journal": "The Journal of urology", "date": "1996", "authors": "Thigpen AE, Cala KM, Guileyardo JM, Molberg KH, McConnell JD, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8583621", "url": "https://glygen.org/publication/PubMed/8583621" } ] }, { "title": "NAB2, a corepressor of NGFI-A (Egr-1) and Krox20, is induced by proliferative and differentiative stimuli.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Svaren J, Sevetson BR, Apel ED, Zimonjic DB, Popescu NC, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8668170", "url": "https://glygen.org/publication/PubMed/8668170" } ] }, { "title": "Activation of codependent transcription factors is required for transcriptional induction of the vgf gene by nerve growth factor and Ras.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "D'Arcangelo G, Habas R, Wang S, Halegoua S, Salton SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8756618", "url": "https://glygen.org/publication/PubMed/8756618" } ] }, { "title": "The cdk5/p35 kinase is essential for neurite outgrowth during neuronal differentiation.", "journal": "Genes & development", "date": "1996", "authors": "Nikolic M, Dudek H, Kwon YT, Ramos YF, Tsai LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8846918", "url": "https://glygen.org/publication/PubMed/8846918" } ] }, { "title": "p300 is a component of an estrogen receptor coactivator complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Hanstein B, Eckner R, DiRenzo J, Halachmi S, Liu H, Searcy B, Kurokawa R, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8876171", "url": "https://glygen.org/publication/PubMed/8876171" } ] }, { "title": "The transcription factors SCIP and Krox-20 mark distinct stages and cell fates in Schwann cell differentiation.", "journal": "Molecular and cellular neurosciences", "date": "1996", "authors": "Zorick TS, Syroid DE, Arroyo E, Scherer SS, Lemke G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8918830", "url": "https://glygen.org/publication/PubMed/8918830" } ] }, { "title": "Sequence analysis and expression in cultured lymphocytes of the human FOSB gene (G0S3).", "journal": "DNA Cell Biol.", "date": "1996", "authors": "Forsdyke D.R., Russell L., Cristillo A.D., Heximer S.P.", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "reference": [ { "type": "PubMed", "id": "8985116", "url": "https://glygen.org/publication/PubMed/8985116" } ] }, { "title": "Interplay of the E box, the cyclic AMP response element, and HTF4/HEB in transcriptional regulation of the neurospecific, neurotrophin-inducible vgf gene.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Di Rocco G, Pennuto M, Illi B, Canu N, Filocamo G, Trani E, Rinaldi AM, Possenti R, Mandolesi G, Sirinian MI, Jucker R, Levi A, Nasi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9032251", "url": "https://glygen.org/publication/PubMed/9032251" } ] }, { "title": "Molecular cloning and characterization of the human VGF promoter region.", "journal": "Journal of neurochemistry", "date": "1997", "authors": "Canu N, Possenti R, Rinaldi AM, Trani E, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9084409", "url": "https://glygen.org/publication/PubMed/9084409" } ] }, { "title": "Identification of a functional imperfect estrogen-responsive element in the 5'-promoter region of the human cathepsin D gene.", "journal": "Biochemistry", "date": "1997", "authors": "Wang F, Porter W, Xing W, Archer TK, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9201922", "url": "https://glygen.org/publication/PubMed/9201922" } ] }, { "title": "Molecular basis of agonism and antagonism in the oestrogen receptor.", "journal": "Nature", "date": "1997", "authors": "Brzozowski AM, Pike AC, Dauter Z, Hubbard RE, Bonn T, Engstrom O, Ohman L, Greene GL, Gustafsson JA, Carlquist M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9338790", "url": "https://glygen.org/publication/PubMed/9338790" } ] }, { "title": "Role of cyclins in neuronal differentiation of immortalized hippocampal cells.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Xiong W, Pestell R, Rosner MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9343422", "url": "https://glygen.org/publication/PubMed/9343422" } ] }, { "title": "Nucleosome positioning and transcription-associated chromatin alterations on the human estrogen-responsive pS2 promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Sewack GF, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9388265", "url": "https://glygen.org/publication/PubMed/9388265" } ] }, { "title": "CREB: a major mediator of neuronal neurotrophin responses.", "journal": "Neuron", "date": "1997", "authors": "Finkbeiner S, Tavazoie SF, Maloratsky A, Jacobs KM, Harris KM, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9390517", "url": "https://glygen.org/publication/PubMed/9390517" } ] }, { "title": "Nab1, a corepressor of NGFI-A (Egr-1), contains an active transcriptional repression domain.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Swirnoff AH, Apel ED, Svaren J, Sevetson BR, Zimonjic DB, Popescu NC, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9418898", "url": "https://glygen.org/publication/PubMed/9418898" } ] }, { "title": "Functional and physical interactions between the estrogen receptor Sp1 and nuclear aryl hydrocarbon receptor complexes.", "journal": "Nucleic acids research", "date": "1998", "authors": "Wang F, Hoivik D, Pollenz R, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9611253", "url": "https://glygen.org/publication/PubMed/9611253" } ] }, { "title": "Expression of early growth response genes in human prostate cancer.", "journal": "Cancer research", "date": "1998", "authors": "Eid MA, Kumar MV, Iczkowski KA, Bostwick DG, Tindall DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9622090", "url": "https://glygen.org/publication/PubMed/9622090" } ] }, { "title": "c-Myc or cyclin D1 mimics estrogen effects on cyclin E-Cdk2 activation and cell cycle reentry.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Prall OW, Rogan EM, Musgrove EA, Watts CK, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9671459", "url": "https://glygen.org/publication/PubMed/9671459" } ] }, { "title": "The transcriptional corepressor NAB2 inhibits NGF-induced differentiation of PC12 cells.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Qu Z, Wolfraim LA, Svaren J, Ehrengruber MU, Davidson N, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9722618", "url": "https://glygen.org/publication/PubMed/9722618" } ] }, { "title": "Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Xing W, Archer TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9731700", "url": "https://glygen.org/publication/PubMed/9731700" } ] }, { "title": "Rsk-2 activity is necessary for epidermal growth factor-induced phosphorylation of CREB protein and transcription of c-fos gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "De Cesare D, Jacquot S, Hanauer A, Sassone-Corsi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9770464", "url": "https://glygen.org/publication/PubMed/9770464" } ] }, { "title": "Novel mutants of NAB corepressors enhance activation by Egr transactivators.", "journal": "The EMBO journal", "date": "1998", "authors": "Svaren J, Sevetson BR, Golda T, Stanton JJ, Swirnoff AH, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9774344", "url": "https://glygen.org/publication/PubMed/9774344" } ] }, { "title": "Synaptic activation causes the mRNA for the IEG Arc to localize selectively near activated postsynaptic sites on dendrites.", "journal": "Neuron", "date": "1998", "authors": "Steward O, Wallace CS, Lyford GL, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9808461", "url": "https://glygen.org/publication/PubMed/9808461" } ] }, { "title": "Evidence for the participation of the neuron-specific CDK5 activator P35 during laminin-enhanced axonal growth.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1998", "authors": "Paglini G, Pigino G, Kunda P, Morfini G, Maccioni R, Quiroga S, Ferreira A, Caceres A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9822744", "url": "https://glygen.org/publication/PubMed/9822744" } ] }, { "title": "Inducible and constitutive transcription factors in the mammalian nervous system: control of gene expression by Jun, Fos and Krox, and CREB/ATF proteins.", "journal": "Brain research. Brain research reviews", "date": "1998", "authors": "Herdegen T, Leah JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9858769", "url": "https://glygen.org/publication/PubMed/9858769" } ] } ], "pathway": [ { "id": "hsa:2354", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2354", "resource": "KEGG Pathway" }, { "id": "R-HSA-9018519", "name": "Estrogen-dependent gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-HSA-9031628", "name": "NGF-stimulated transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628", "resource": "Reactome", "description": "NGF-stimulated transcription" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZLB7-1", "protein_name": "Protein FosB", "gene_name": "Fosb", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPAVDPYDMPGTSYSTPGLSAYSTGGASGSGGPSTSTSTSGPVSARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSTSAKEDGFGWLLPPPPPPPLPFQSSRDAPPNLTASLFTHSEVQVLGDPFPVVSPSYTSSFVLTCPEVSAFAGSQRTSGSEQPSDPLNSPSLLAL", "length": 338 }, "evidence": [ { "id": "45228965", "url": "http://www.informatics.jax.org/homology/45228965", "database": "MGI" }, { "id": "P53539", "url": "https://omabrowser.org/oma/group/P53539/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P13346-1", "protein_name": "Protein FosB", "gene_name": "Fosb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPAVDPYDMPGTSYSTPGLSAYSTGGASGSGGPSTSTTTSGPVSARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSTSAKEDGFGWLLPPPPPPPLPFQSSRDAPPNLTASLFTHSEVQVLGDPFPVVSPSYTSSFVLTCPEVSAFAGAQRTSGSEQPSDPLNSPSLLAL", "length": 338 }, "evidence": [ { "id": "45228965", "url": "http://www.informatics.jax.org/homology/45228965", "database": "MGI" }, { "id": "P53539", "url": "https://omabrowser.org/oma/group/P53539/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "cellular response to calcium ion", "id": "GO:0071277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071277", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "female pregnancy", "id": "GO:0007565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007565", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "response to mechanical stimulus", "id": "GO:0009612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009612", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "response to progesterone", "id": "GO:0032570", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032570", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "cellular response to hormone stimulus", "id": "GO:0032870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032870", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "transcription by RNA polymerase II", "id": "GO:0006366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "response to corticosterone", "id": "GO:0051412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051412", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "response to cAMP", "id": "GO:0051591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051591", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 275, "end_pos": 277, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated at Ser-27 by CSNK2A1; phosphorylation increases protein stability and transactivation potential.", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" }, { "database": "PubMed", "id": "P13346", "url": "https://glygen.org/publication/PubMed/P13346" } ] }, { "annotation": "Phosphorylated.", "evidence": [ { "database": "UniProtKB", "id": "P53539", "url": "https://www.uniprot.org/uniprot/P53539" }, { "database": "PubMed", "id": "D3ZLB7", "url": "https://glygen.org/publication/PubMed/D3ZLB7" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 263 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }