{ "uniprot_canonical_ac": "P53220-1", "uniprot_ac": "P53220", "uniprot_id": "TIM21_YEAST", "mass": { "chemical_mass": 27206.0, "monoisotopic_mass": 27206.0 }, "refseq": { "ac": "NP_011547", "name": "Tim21p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011547" }, "gene_names": [ { "name": "TIM21", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P53220", "id": "P53220" }, { "name": "TIM21", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011547", "id": "NP_011547" } ], "protein_names": [ { "name": "Mitochondrial import inner membrane translocase subunit TIM21", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P53220" }, { "name": "Tim21p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011547", "id": "NP_011547" } ], "function": [ { "annotation": "Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Required to keep the TOM and the TIM23 complexes in close contact. At some point, it is released from the TOM23 complex to allow protein translocation into the mitochondrial matrix. In the complex, it acts as an antagonist of TIM50 by reducing preprotein accumulation at the TOM23 complex and promotes dissociation of the PAM complex from the TIM23 complex.", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220#function" }, { "database": "PubMed", "id": "15878866", "url": "https://glygen.org/publication/PubMed/15878866" }, { "database": "PubMed", "id": "15797382", "url": "https://glygen.org/publication/PubMed/15797382" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "common_name": "Yeast" } ], "gene": [ { "name": "TIM21", "url": "https://www.uniprot.org/uniprot/P53220", "locus": {} } ], "crossref": [ { "id": "852921", "url": "https://www.ncbi.nlm.nih.gov/gene/852921", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P53220", "url": "https://www.ebi.ac.uk/intact/interactors/id:P53220*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013261", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013261", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038552", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038552", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YGR033C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR033C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HVESKQK", "url": "https://omabrowser.org/oma/group/HVESKQK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1386256at2759", "url": "http://www.orthodb.org/?query=1386256at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13032", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13032", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13032:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13032:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2CIU", "url": "https://www.rcsb.org/structure/2CIU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MF7", "url": "https://www.rcsb.org/structure/2MF7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6K7D", "url": "https://www.rcsb.org/structure/6K7D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6K7E", "url": "https://www.rcsb.org/structure/6K7E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6K7F", "url": "https://www.rcsb.org/structure/6K7F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6K8Q", "url": "https://www.rcsb.org/structure/6K8Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF08294", "url": "http://pfam.xfam.org/family/PF08294", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P53220", "url": "http://purl.obolibrary.org/obo/PR_P53220", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_011547", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011547", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000003265", "url": "https://www.yeastgenome.org/locus/S000003265", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P53220-1", "url": "https://www.uniprot.org/uniprot/P53220-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSSLPRSLLRLGHRKPLFPRYNTFVNSSVITHTSLLRTRLYSNGTGATSGKKDDKTRNKPKPLWPQVKSASTFTFSGILVIGAVGISAIVIYLILSELFSPSGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSNSKGFLGIRWGPRKD", "length": 239, "header": "sp|P53220-1|TIM21_YEAST Isoform 1 of Mitochondrial import inner membrane translocase subunit TIM21 OS=Saccharomyces cerevisiae S288C OX=559292 GN=TIM21 PE=1 SV=1 CANONICAL=P53220-1" }, "isoforms": [ { "isoform_ac": "P53220-1", "url": "", "sequence": { "sequence": "MSSSLPRSLLRLGHRKPLFPRYNTFVNSSVITHTSLLRTRLYSNGTGATSGKKDDKTRNKPKPLWPQVKSASTFTFSGILVIGAVGISAIVIYLILSELFSPSGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSNSKGFLGIRWGPRKD", "length": 239, "header": "sp|P53220-1|TIM21_YEAST Isoform 1 of Mitochondrial import inner membrane translocase subunit TIM21 OS=Saccharomyces cerevisiae S288C OX=559292 GN=TIM21 PE=1 SV=1 CANONICAL=P53220-1" }, "locus": { "chromosome": "VII", "start_pos": 554967, "end_pos": 554251, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YGR033C_mRNA", "url": "https://www.ensembl.org/id/YGR033C_mRNA" }, { "database": "Ensembl Peptide", "id": "YGR033C", "url": "https://www.ensembl.org/id/YGR033C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Mitochondrial presequence translocase: switching between TOM tethering and motor recruitment involves Tim21 and Tim17.", "journal": "Cell", "date": "2005", "authors": "Chacinska Agnieszka, Lind Maria, Frazier Ann E, Dudek Jan, Meisinger Chris, Geissler Andreas, Sickmann Albert, Meyer Helmut E, Truscott Kaye N, Guiard Bernard, Pfanner Nikolaus, Rehling Peter", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "reference": [ { "type": "PubMed", "id": "15797382", "url": "https://glygen.org/publication/PubMed/15797382" } ] }, { "title": "Role of Tim21 in mitochondrial translocation contact sites.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Hell K., Neupert W., Mokranjac D., Popov-Celeketic D.", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "reference": [ { "type": "PubMed", "id": "15878866", "url": "https://glygen.org/publication/PubMed/15878866" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII.", "journal": "Nature", "date": "1997", "authors": "Mewes H.-W., Minenkova O., Schaefer M., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Hansen M., Rose M., Durand P., Brueckner M., Plevani P., Netter P., Rieger M., Zimmermann M., Portetelle D., Wolf K., Bertani I., Delius H., Kleine K., Portillo F., Hofmann B., Albers M., Schaefer B., Kramer W., Castagnoli L., Volckaert G., Koetter P., Entian K.-D., Kramer B., Rinaldi T., Thierry A., Louis E.J., Vandenbol M., Martegani E., Robben J., Nombela C., Vanoni M., Arroyo J., Eraso P., Mazon M.J., James C.M., Carignani G., Dujon B., Feuermann M., Goffeau A., Hani J., Hilger F., Klima R., Mueller-Auer S., Oliver S.G., Potier S., Rodrigues-Pousada C., Schmidheini T., Souciet J.-L., Steensma H.Y., Zollner A., Bruschi C.V., Escribano V., Frontali L., Guerreiro P., Mazzoni C., Purnelle B., Rodriguez-Torres A.M., Skala J., Talla E., Voet M., de Wergifosse P., Agostoni-Carbone M.L., Albermann K., Backes U., Barreiros T., Bjourson A.J., Cerdan E., Clemente M.L., Coblenz A., Coglievina M., Coissac E., Defoor E., Del Bino S., Delneri D., Fabiani L., Fartmann B., Feroli F., Garcia-Gonzalez M., Garcia-Saez M.I., Hebling U., Hernandez K., Heumann K., Indge K.J., Lauquin G., Leuther H., Maillier E., Marconi A., McReynolds A.D.K., Melchioretto P., Nawrocki A., Neu R., Panzeri L., Paoluzi S., Riles L., Rodriguez-Belmonte E., Ruzzi M., Saliola M., Sanchez-Perez M., Schreer A., Tettelin H., Van Dyck L., Watson M.D., Weber N., Wedler E., Wipfli P., Wright L.F., Zaccaria P., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "reference": [ { "type": "PubMed", "id": "9169869", "url": "https://glygen.org/publication/PubMed/9169869" } ] }, { "title": "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII.", "journal": "Yeast", "date": "1997", "authors": "Rieger M, Br\u00fcckner M, Sch\u00e4fer M, M\u00fcller-Auer S", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "reference": [ { "type": "PubMed", "id": "9290212", "url": "https://glygen.org/publication/PubMed/9290212" } ] } ], "pathway": [ { "id": "sce:YGR033C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR033C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "pmid": "" }, { "name": "TIM23 mitochondrial import inner membrane translocase complex", "id": "GO:0005744", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005744", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "protein insertion into mitochondrial inner membrane", "id": "GO:0045039", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045039", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "pmid": "" }, { "name": "protein import into mitochondrial matrix", "id": "GO:0030150", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030150", "evidence": [ { "database": "UniProtKB", "id": "P53220", "url": "https://www.uniprot.org/uniprot/P53220" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 27, "end_pos": 29, "annotation": "n_glycosylation_sequon" }, { "start_pos": 44, "end_pos": 46, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }