{ "uniprot_canonical_ac": "P52491-1", "uniprot_ac": "P52491", "uniprot_id": "UBC12_YEAST", "mass": { "chemical_mass": 21203.0, "monoisotopic_mass": 21203.0 }, "refseq": { "ac": "NP_013409", "name": "NEDD8-conjugating protein UBC12", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013409" }, "gene_names": [ { "name": "UBC12", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P52491", "id": "P52491" }, { "name": "L2142.3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P52491", "id": "P52491" }, { "name": "UBC12", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013409", "id": "NP_013409" } ], "protein_names": [ { "name": "NEDD8-conjugating enzyme UBC12", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P52491" }, { "name": "2.3.2.34", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P52491" }, { "name": "NEDD8-conjugating protein UBC12", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013409", "id": "NP_013409" }, { "name": "RUB1-conjugating enzyme", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P52491" }, { "name": "Ubiquitin carrier protein 12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P52491" } ], "function": [ { "annotation": "Accepts the ubiquitin-like protein NEDD8/RUB1 from the UBA3-ULA1 E1 complex and catalyzes its covalent attachment to other proteins. The major substrate is CDC53/Cullin.", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491#function" }, { "database": "PubMed", "id": "9545234", "url": "https://glygen.org/publication/PubMed/9545234" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" } ], "common_name": "Yeast" } ], "gene": [ { "name": "UBC12", "url": "https://www.uniprot.org/uniprot/P52491", "locus": {} } ], "crossref": [ { "id": "cd00195", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00195", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "851015", "url": "https://www.ncbi.nlm.nih.gov/gene/851015", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P52491", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52491*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000608", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000608", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016135", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016135", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023313", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023313", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YLR306W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR306W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CEGEKEF", "url": "https://omabrowser.org/oma/group/CEGEKEF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "46085at2759", "url": "http://www.orthodb.org/?query=46085at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24067", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24067", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24067:SF261", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24067:SF261", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3O2U", "url": "https://www.rcsb.org/structure/3O2U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3TDI", "url": "https://www.rcsb.org/structure/3TDI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00179", "url": "http://pfam.xfam.org/family/PF00179", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P52491", "url": "http://purl.obolibrary.org/obo/PR_P52491", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013409", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013409", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004297", "url": "https://www.yeastgenome.org/locus/S000004297", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P52491-1", "url": "https://www.uniprot.org/uniprot/P52491-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLKLRQLQKKKQKENENSSSIQPNLSAARIRLKRDLDSLDLPPTVTLNVITSPDSADRSQSPKLEVIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAVRLTMSGGSIEHVKYDNIVSP", "length": 188, "header": "sp|P52491-1|UBC12_YEAST Isoform 1 of NEDD8-conjugating enzyme UBC12 OS=Saccharomyces cerevisiae S288C OX=559292 GN=UBC12 PE=1 SV=1 CANONICAL=P52491-1" }, "isoforms": [ { "isoform_ac": "P52491-1", "url": "", "sequence": { "sequence": "MLKLRQLQKKKQKENENSSSIQPNLSAARIRLKRDLDSLDLPPTVTLNVITSPDSADRSQSPKLEVIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAVRLTMSGGSIEHVKYDNIVSP", "length": 188, "header": "sp|P52491-1|UBC12_YEAST Isoform 1 of NEDD8-conjugating enzyme UBC12 OS=Saccharomyces cerevisiae S288C OX=559292 GN=UBC12 PE=1 SV=1 CANONICAL=P52491-1" }, "locus": { "chromosome": "XII", "start_pos": 744848, "end_pos": 744151, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YLR306W_mRNA", "url": "https://www.ensembl.org/id/YLR306W_mRNA" }, { "database": "Ensembl Peptide", "id": "YLR306W", "url": "https://www.ensembl.org/id/YLR306W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.", "journal": "Science", "date": "2011", "authors": "Scott DC, Monda JK, Bennett EJ, Harper JW, Schulman BA", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" } ], "reference": [ { "type": "PubMed", "id": "21940857", "url": "https://glygen.org/publication/PubMed/21940857" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Duesterhoeft A., Hillier L.W., Mewes H.-W., Obermaier B., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Rose M., Benes V., Brueckner M., Rieger M., Portetelle D., Delius H., Schwarz S., Kleine K., Floeth M., Schwager C., Voss H., Hoheisel J.D., Dubois E., Volckaert G., Andre B., Koetter P., Entian K.-D., Louis E.J., Vandenbol M., Johnston M., Pohl T.M., Goffeau A., Hani J., Hilger F., Messenguy F., Miosga T., Mueller-Auer S., Scherens B., Zimmermann F.K., Zollner A., Purnelle B., Urrestarazu L.A., Vierendeels F., Voet M., Albermann K., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Moestl D., Nentwich U., Piravandi E., Rechmann S., Riles L., Rinke M., Scholler P., Underwood A.P., Wedler E.", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" } ], "reference": [ { "type": "PubMed", "id": "9169871", "url": "https://glygen.org/publication/PubMed/9169871" } ] }, { "title": "A novel protein modification pathway related to the ubiquitin system.", "journal": "EMBO J.", "date": "1998", "authors": "Jentsch S., Liakopoulos D., Matuschewski K., Doenges G.", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" } ], "reference": [ { "type": "PubMed", "id": "9545234", "url": "https://glygen.org/publication/PubMed/9545234" } ] } ], "pathway": [ { "id": "sce:YLR306W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR306W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "NEDD8 conjugating enzyme activity", "id": "GO:0061654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061654", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" } ], "pmid": "" }, { "name": "NEDD8 transferase activity", "id": "GO:0019788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019788", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "protein neddylation", "id": "GO:0045116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045116", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 17, "end_pos": 19, "annotation": "n_glycosylation_sequon" }, { "start_pos": 24, "end_pos": 26, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "The acetylation of Met-1 is cotranslational, and not regulatory. The N-acetylmethionine increases affinity for DCUN1D1 by about 2 orders of magnitude and is crucial for NEDD8 transfer to cullins.", "evidence": [ { "database": "UniProtKB", "id": "P52491", "url": "https://www.uniprot.org/uniprot/P52491" }, { "database": "PubMed", "id": "21940857", "url": "https://glygen.org/publication/PubMed/21940857" } ] } ], "interactions": [], "reactions": [ { "id": "R-SCE-8951661", "name": "Transfer of NEDD8 to AcM-UBE2M", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P52491-1", "P22515-1", "Q99344-1" ], "evidence": [ { "id": "R-SCE-8951661", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-8951661" } ] }, { "id": "R-SCE-8951751", "name": "Doubly neddylated UBA3:NAE1 binds AcM-UBE2M", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P52491-1", "P22515-1", "Q99344-1" ], "evidence": [ { "id": "R-SCE-8951751", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-8951751" } ] }, { "id": "R-SCE-8951764", "name": "Transfer of NEDD8 to AcM-UBE2F", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P52491-1", "P22515-1", "Q99344-1" ], "evidence": [ { "id": "R-SCE-8951764", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-8951764" } ] }, { "id": "R-SCE-8951766", "name": "Doubly neddylated UBA3:NAE1 binds AcM-UBE2F", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P52491-1", "P22515-1", "Q99344-1" ], "evidence": [ { "id": "R-SCE-8951766", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-8951766" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P22515", "gene_name": "UBA1", "activity": [ { "ec_number": "6.2.1.45", "activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.", "evidence": [ { "id": "P22515", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22515" } ] }, { "ec_number": "6.2.1.45", "activity": "", "evidence": [ { "id": "P22515", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22515" } ] } ] }, { "uniprot_ac": "P52491", "gene_name": "UBC12", "activity": [ { "ec_number": "2.3.2.34", "activity": "[E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine + [E2 NEDD8-conjugating enzyme]-L-cysteine = [E1 NEDD8-activating enzyme]-L-cysteine + [E2 NEDD8-conjugating enzyme]-S-[NEDD8-protein]-yl-L-cysteine.", "evidence": [ { "id": "P52491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52491" } ] }, { "ec_number": "2.3.2.34", "activity": "", "evidence": [ { "id": "P52491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52491" } ] } ] }, { "uniprot_ac": "Q99344", "gene_name": "UBA3", "activity": [ { "ec_number": "6.2.1.64", "activity": "ATP + [NEDD8 protein] + [E1 NEDD8-activating enzyme]-L-cysteine = AMP + diphosphate + [E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine.", "evidence": [ { "id": "Q99344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99344" } ] }, { "ec_number": "6.2.1.64", "activity": "", "evidence": [ { "id": "Q99344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99344" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }