{ "uniprot_canonical_ac": "P51680-1", "uniprot_ac": "P51680", "uniprot_id": "CCR4_MOUSE", "mass": { "chemical_mass": 41408.0, "monoisotopic_mass": 41408.0 }, "refseq": { "ac": "NP_034046", "name": "C-C chemokine receptor type 4", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046" }, "gene_names": [ { "name": "Ccr4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P51680", "id": "P51680" }, { "name": "C-C CKR-4; CHEMR1; Cmkbr4; LESTR; Sdf1r", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046", "id": "NP_034046" }, { "name": "Ccr4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046", "id": "NP_034046" }, { "name": "Cmkbr4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P51680", "id": "P51680" } ], "protein_names": [ { "name": "C-C chemokine receptor type 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P51680" }, { "name": "C-C CKR-4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P51680" }, { "name": "C-C chemokine receptor type 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046", "id": "NP_034046" }, { "name": "CC-CKR-4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P51680" }, { "name": "CCR-4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P51680" }, { "name": "CCR4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P51680" }, { "name": "fusin; leukocyte-expressed seven-transmembrane-domain receptor; chemokine (C-C) receptor 4; chemokine (C-C motif) receptor 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046", "id": "NP_034046" } ], "function": [ { "annotation": "CCR4 and CCR7 differentially regulate thymocyte localization with distinct outcomes for central tolerance. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_034046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046" }, { "database": "PubMed", "id": "37266571", "url": "https://glygen.org/publication/PubMed/37266571" } ] }, { "annotation": "CCR4 plays a pivotal role in Th17 cell recruitment and expansion in a mouse model of rheumatoid arthritis.", "evidence": [ { "database": "RefSeq", "id": "NP_034046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046" }, { "database": "PubMed", "id": "35997787", "url": "https://glygen.org/publication/PubMed/35997787" } ] }, { "annotation": "Fluid flow-induced left-right asymmetric decay of Dand5 mRNA in the mouse embryo requires a Bicc1-Ccr4 RNA degradation complex. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_034046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046" }, { "database": "PubMed", "id": "34210974", "url": "https://glygen.org/publication/PubMed/34210974" } ] }, { "annotation": "High affinity receptor for the C-C type chemokines CCL17/TARC and CCL22/MDC. The activity of this receptor is mediated by G(i) proteins which activate a phosphatidylinositol-calcium second messenger system. Could play a role in lipopolysaccharide (LPS)-induced endotoxic shock. In the CNS, could mediate hippocampal-neuron survival.", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680#function" }, { "database": "PubMed", "id": "10811868", "url": "https://glygen.org/publication/PubMed/10811868" } ] }, { "annotation": "Skin-resident dendritic cells mediate postoperative pain via CCR4 on sensory neurons.", "evidence": [ { "database": "RefSeq", "id": "NP_034046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046" }, { "database": "PubMed", "id": "35046040", "url": "https://glygen.org/publication/PubMed/35046040" } ] } ], "disease": [ { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ], "evidence": [ { "id": "1793", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1793" } ] }, { "disease_id": "DOID:2841", "recommended_name": { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "asthma", "description": "A bronchial disease that is characterized by chronic inflammation and narrowing of the airways, which is caused by a combination of environmental and genetic factors. The disease has_symptom recurring periods of wheezing (a whistling sound while breathing), has_symptom chest tightness, has_symptom shortness of breath, has_symptom mucus production and has_symptom coughing." }, "synonyms": [ { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "Exercise induced asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "bronchial hyperreactivity", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with acute exacerbation", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with status asthmaticus", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "exercise-induced asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "inherited susceptibility to asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, nocturnal, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, bronchial", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, diminished response to Antileukotriene treatment 1N", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, protection against", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma-related traits, susceptibility to", "description": "" }, { "id": "MIM:600807", "resource": "MIM", "url": "https://www.omim.org/entry/600807", "name": "Asthma", "description": "Asthma" } ], "evidence": [ { "id": "2841", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2841" } ] }, { "disease_id": "DOID:3744", "recommended_name": { "id": "DOID:3744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3744", "name": "cervical squamous cell carcinoma", "description": "A cervix carcinoma that has_material_basis_in squamous cells of the cervix." }, "synonyms": [ { "id": "DOID:3744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3744", "name": "squamous cell carcinoma of cervix", "description": "" }, { "id": "DOID:3744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3744", "name": "squamous cell carcinoma of the Cervix Uteri", "description": "" } ], "evidence": [ { "id": "3744", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3744" } ] }, { "disease_id": "DOID:3770", "recommended_name": { "id": "DOID:3770", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3770", "name": "pulmonary fibrosis", "description": "An interstitial lung disease that is characterized by destruction, scarring, and thickening of the interstitial lung tissues and progressive pulmonary function loss in a restrictive pattern, has_symptom progressive shortness of breath, fatigue, and chronic cough, possibly has_material_basis_in exposure to certain chemicals, autoimmune conditions, and radiation." }, "synonyms": [ { "id": "DOID:3770", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3770", "name": "Fibrosis of lung", "description": "" } ], "evidence": [ { "id": "3770", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3770" } ] }, { "disease_id": "DOID:7148", "recommended_name": { "id": "DOID:7148", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7148", "name": "rheumatoid arthritis", "description": "An arthritis that is an autoimmune disease which attacks healthy cells and tissue located_in joint." }, "synonyms": [ { "id": "DOID:7148", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7148", "name": "Arthritis or polyarthritis, rheumatic", "description": "" }, { "id": "DOID:7148", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7148", "name": "atrophic Arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis", "description": "A chronic, systemic autoimmune disorder characterized by inflammation in the synovial membranes and articular surfaces. It manifests primarily as a symmetric, erosive polyarthritis that spares the axial skeleton and is typically associated with the presence in the serum of rheumatoid factor." }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "atrophic arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "RA", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "arthritis or polyarthritis, rheumatic", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "arthritis, rheumatoid", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "autoimmune arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis, progression of", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis, susceptibility to", "description": "" }, { "id": "MIM:180300", "resource": "MIM", "url": "https://www.omim.org/entry/180300", "name": "Rheumatoid arthritis", "description": "Rheumatoid arthritis" } ], "evidence": [ { "id": "7148", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:7148" } ] }, { "disease_id": "DOID:8398", "recommended_name": { "id": "DOID:8398", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8398", "name": "osteoarthritis", "description": "An arthritis that has_material_basis_in worn out cartilage located_in joint." }, "synonyms": [ { "id": "DOID:8398", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8398", "name": "Osteoarthrosis and allied disorder", "description": "" }, { "id": "DOID:8398", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8398", "name": "degenerative arthritis", "description": "" }, { "id": "DOID:8398", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8398", "name": "degenerative joint disease", "description": "" }, { "id": "DOID:8398", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8398", "name": "hypertrophic arthritis", "description": "" }, { "id": "DOID:8398", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8398", "name": "osteoarthrosis", "description": "" } ], "evidence": [ { "id": "8398", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8398" } ] } ], "snv": [ { "evidence": [ { "id": "rs3389081348", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389081348" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 82, "end_pos": 82, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLT).", "chr_id": "9", "chr_pos": "114321820", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A82", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ccr4", "url": "https://www.uniprot.org/uniprot/P51680", "locus": { "chromosome": "9", "start_pos": 114319384, "end_pos": 114333984, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000047898", "url": "https://www.ensembl.org/id/ENSMUSG00000047898" } ] } } ], "crossref": [ { "id": "ENSMUSG00000047898", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000047898", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd14984", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14984", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5410", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5410", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "12773", "url": "https://www.ncbi.nlm.nih.gov/gene/12773", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P51680", "url": "https://www.ebi.ac.uk/intact/interactors/id:P51680*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000355", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000355", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002239", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002239", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:12773", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12773", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "107824", "url": "http://www.informatics.jax.org/marker/MGI:107824", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "FHTQSTG", "url": "https://omabrowser.org/oma/group/FHTQSTG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4604454at2759", "url": "http://www.orthodb.org/?query=4604454at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10489", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10489", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10489:SF608", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10489:SF608", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P51680", "url": "http://purl.obolibrary.org/obo/PR_P51680", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-380108", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_034046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1L1STS0", "url": "https://www.uniprot.org/uniprot/A0A1L1STS0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1L1STS0-1", "url": "https://www.uniprot.org/uniprot/A0A1L1STS0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P51680-1", "url": "https://www.uniprot.org/uniprot/P51680-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNATEVTDTTQDETVYNSYYFYESMPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVVVLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIVSWMYLVGFYSGIFFIMLMSIDRYLAIVHAVFSLKARTLTYGVITSLITWSVAVFASLPGLLFSTCYTEHNHTYCKTQYSVNSTTWKVLSSLEINVLGLLIPLGIMLFCYSMIIRTLQHCKNEKKNRAVRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLNPVIYFFLGEKFRKYITQLFRTCRGPLVLCKHCDFLQVYSADMSSSSYTQSTVDHDFRDAL", "length": 360, "header": "sp|P51680-1|CCR4_MOUSE Isoform 1 of C-C chemokine receptor type 4 OS=Mus musculus OX=10090 GN=Ccr4 PE=2 SV=2 CANONICAL=P51680-1" }, "isoforms": [ { "isoform_ac": "A0A1L1STS0-1", "url": "", "sequence": { "sequence": "MNATEVTDTTQDETVYNSYYFYESMPKPCTKE", "length": 32, "header": "tr|A0A1L1STS0-1|A0A1L1STS0_MOUSE Computationally mapped isoform of Chemokine (C-C motif) receptor 4 OS=Mus musculus OX=10090 GN=Ccr4 PE=4 SV=1 CANONICAL=P51680-1" }, "locus": { "chromosome": "9", "start_pos": 114322063, "end_pos": 114321968, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000215959.2", "url": "https://www.ensembl.org/id/ENSMUST00000215959.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000150441.2", "url": "https://www.ensembl.org/id/ENSMUSP00000150441.2" } ] } }, { "isoform_ac": "P51680-1", "url": "", "sequence": { "sequence": "MNATEVTDTTQDETVYNSYYFYESMPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVVVLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIVSWMYLVGFYSGIFFIMLMSIDRYLAIVHAVFSLKARTLTYGVITSLITWSVAVFASLPGLLFSTCYTEHNHTYCKTQYSVNSTTWKVLSSLEINVLGLLIPLGIMLFCYSMIIRTLQHCKNEKKNRAVRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLNPVIYFFLGEKFRKYITQLFRTCRGPLVLCKHCDFLQVYSADMSSSSYTQSTVDHDFRDAL", "length": 360, "header": "sp|P51680-1|CCR4_MOUSE Isoform 1 of C-C chemokine receptor type 4 OS=Mus musculus OX=10090 GN=Ccr4 PE=2 SV=2 CANONICAL=P51680-1" }, "locus": { "chromosome": "9", "start_pos": 114322063, "end_pos": 114320984, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000054414", "url": "https://www.ensembl.org/id/ENSMUST00000054414" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000062677", "url": "https://www.ensembl.org/id/ENSMUSP00000062677" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 183, "start_aa": "Asn", "end_pos": 183, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn183", "evidence": [ { "id": "P51680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51680#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 194, "start_aa": "Asn", "end_pos": 194, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn194", "evidence": [ { "id": "P51680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51680#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2, "start_aa": "Asn", "end_pos": 2, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2", "evidence": [ { "id": "P51680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51680#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "A key role for CC chemokine receptor 4 in lipopolysaccharide-induced endotoxic shock.", "journal": "J. Exp. Med.", "date": "2000", "authors": "Wells T.N.C., Power C.A., Proudfoot A.E.I., Buser R., Conquet F.", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "reference": [ { "type": "PubMed", "id": "10811868", "url": "https://glygen.org/publication/PubMed/10811868" } ] }, { "title": "Fluid flow-induced left-right asymmetric decay of Dand5 mRNA in the mouse embryo requires a Bicc1-Ccr4 RNA degradation complex.", "journal": "Nature communications", "date": "2021", "authors": "Minegishi K, Rothe B, Komatsu KR, Ono H, Ikawa Y, Nishimura H, Katoh TA, Kajikawa E, Sai X, Miyashita E, Takaoka K, Bando K, Kiyonari H, Yamamoto T, Saito H, Constam DB, Hamada H", "evidence": [ { "database": "RefSeq", "id": "NP_034046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046" } ], "reference": [ { "type": "PubMed", "id": "34210974", "url": "https://glygen.org/publication/PubMed/34210974" } ] }, { "title": "Skin-resident dendritic cells mediate postoperative pain via CCR4 on sensory neurons.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2022", "authors": "Silva JR, Iftinca M, Fernandes Gomes FI, Segal JP, Smith OMA, Bannerman CA, Silva Mendes A, Defaye M, Robinson MEC, Gilron I, Cunha TM, Altier C, Ghasemlou N", "evidence": [ { "database": "RefSeq", "id": "NP_034046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046" } ], "reference": [ { "type": "PubMed", "id": "35046040", "url": "https://glygen.org/publication/PubMed/35046040" } ] }, { "title": "CCR4 plays a pivotal role in Th17 cell recruitment and expansion in a mouse model of rheumatoid arthritis.", "journal": "International immunology", "date": "2022-08-23", "authors": "Honzawa Tatsuma, Matsuo Kazuhiko, Hosokawa Shunya, Kamimura Mayu, Kaibori Yuichiro, Hara Yuta, Nagakubo Daisuke, Oiso Naoki, Kawada Akira, Otsuka Atsushi, Yoshie Osamu, Nakayama Takashi", "evidence": [ { "database": "RefSeq", "id": "NP_034046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046" } ], "reference": [ { "type": "PubMed", "id": "35997787", "url": "https://glygen.org/publication/PubMed/35997787" } ] }, { "title": "CCR4 and CCR7 differentially regulate thymocyte localization with distinct outcomes for central tolerance.", "journal": "eLife", "date": "2023-06-02", "authors": "Li Yu, Guaman Tipan Pablo, Selden Hilary J, Srinivasan Jayashree, Hale Laura P, Ehrlich Lauren I R", "evidence": [ { "database": "RefSeq", "id": "NP_034046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034046" } ], "reference": [ { "type": "PubMed", "id": "37266571", "url": "https://glygen.org/publication/PubMed/37266571" } ] }, { "title": "Molecular cloning of murine CC CKR-4 and high affinity binding of chemokines to murine and human CC CKR-4.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1996", "authors": "Wells T.N.C., Black D., Power C.A., Hoogewerf A.J., Proudfoot A.E.I.", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "reference": [ { "type": "PubMed", "id": "8573157", "url": "https://glygen.org/publication/PubMed/8573157" } ] }, { "title": "Molecular cloning and characterization of a cDNA, CHEMR1, encoding a chemokine receptor with a homology to the human C-C chemokine receptor, CCR-4.", "journal": "Blood", "date": "1997", "authors": "Kozak C.A., Lyu M.S., Kim S.-H., Kwon B.S., Youn B.-S., Taub D.D.", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "reference": [ { "type": "PubMed", "id": "9192769", "url": "https://glygen.org/publication/PubMed/9192769" } ] } ], "pathway": [ { "id": "mmu:12773", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12773", "resource": "KEGG Pathway" }, { "id": "R-MMU-380108", "name": "Chemokine receptors bind chemokines", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-380108", "resource": "Reactome", "description": "Chemokine receptors bind chemokines" }, { "id": "R-MMU-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "P51679-1", "protein_name": "C-C chemokine receptor type 4", "gene_name": "CCR4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLNPIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL", "length": 360 }, "evidence": [ { "id": "45229904", "url": "http://www.informatics.jax.org/homology/45229904", "database": "MGI" }, { "id": "P51680", "url": "https://omabrowser.org/oma/group/P51680/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "positive regulation of cytosolic calcium ion concentration", "id": "GO:0007204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "calcium-mediated signaling", "id": "GO:0019722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019722", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "neuron migration", "id": "GO:0001764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001764", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "response to bacterium", "id": "GO:0009617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009617", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "cell chemotaxis", "id": "GO:0060326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060326", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "homeostasis of number of cells", "id": "GO:0048872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048872", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "tolerance induction", "id": "GO:0002507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002507", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "positive regulation of positive chemotaxis", "id": "GO:0050927", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050927", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "interneuron migration", "id": "GO:1904936", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904936", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "C-C chemokine receptor activity", "id": "GO:0016493", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016493", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" }, { "name": "C-C chemokine binding", "id": "GO:0019957", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019957", "evidence": [ { "database": "UniProtKB", "id": "P51680", "url": "https://www.uniprot.org/uniprot/P51680" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 183, "end_pos": 185, "annotation": "n_glycosylation_sequon" }, { "start_pos": 194, "end_pos": 196, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2, "end_pos": 4, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }