{ "uniprot_canonical_ac": "P50543-1", "uniprot_ac": "P50543", "uniprot_id": "S10AB_MOUSE", "mass": { "chemical_mass": 11083.0, "monoisotopic_mass": 11083.0 }, "refseq": { "ac": "NP_058020", "name": "protein S100-A11", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020" }, "gene_names": [ { "name": "S100a11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P50543", "id": "P50543" }, { "name": "S100a11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020", "id": "NP_058020" }, { "name": "S100c", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P50543", "id": "P50543" }, { "name": "cal; Emap1; EMAPI; S100a14; S100c", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020", "id": "NP_058020" } ], "protein_names": [ { "name": "Protein S100-A11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P50543" }, { "name": "Calgizzarin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P50543" }, { "name": "EMAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P50543" }, { "name": "Endothelial monocyte-activating polypeptide", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P50543" }, { "name": "Protein S100-C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P50543" }, { "name": "S100 calcium-binding protein A11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P50543" }, { "name": "calizzarin; EMAP; protein S100-C; endothelial monocyte-activating polypeptide; endothelial monocyte activating polypeptide 1; calgizzarin; S100 calcium binding protein A14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020", "id": "NP_058020" }, { "name": "protein S100-A11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020", "id": "NP_058020" } ], "function": [ { "annotation": "Dicalcin suppresses in vitro trophoblast attachment in human cell lines.", "evidence": [ { "database": "RefSeq", "id": "NP_058020", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020" }, { "database": "PubMed", "id": "34311201", "url": "https://glygen.org/publication/PubMed/34311201" } ] }, { "annotation": "Facilitates the differentiation and the cornification of keratinocytes.", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543#function" } ] }, { "annotation": "S100A11 Promotes Liver Steatosis via FOXO1-Mediated Autophagy and Lipogenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_058020", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020" }, { "database": "PubMed", "id": "33075563", "url": "https://glygen.org/publication/PubMed/33075563" } ] }, { "annotation": "This study shows that alarmin S100A11 initiates a chemokine response to the human pathogen Toxoplasma gondii", "evidence": [ { "database": "RefSeq", "id": "NP_058020", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020" }, { "database": "PubMed", "id": "30455460", "url": "https://glygen.org/publication/PubMed/30455460" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "common_name": "Mouse" } ], "gene": [ { "name": "S100a11", "url": "https://www.uniprot.org/uniprot/P50543", "locus": { "chromosome": "3", "start_pos": 93433594, "end_pos": 93427795, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000027907", "url": "https://www.ensembl.org/id/ENSMUSG00000027907" } ] } } ], "crossref": [ { "id": "ENSMUSG00000027907", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000027907", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05023", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05023", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "20195", "url": "https://www.ncbi.nlm.nih.gov/gene/20195", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P50543", "url": "https://www.ebi.ac.uk/intact/interactors/id:P50543*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001751", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001751", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013787", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013787", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028482", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028482", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:20195", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:20195", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1338798", "url": "http://www.informatics.jax.org/marker/MGI:1338798", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "MACEKCY", "url": "https://omabrowser.org/oma/group/MACEKCY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5310603at2759", "url": "http://www.orthodb.org/?query=5310603at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11639", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11639", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11639:SF60", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11639:SF60", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00036", "url": "http://pfam.xfam.org/family/PF00036", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01023", "url": "http://pfam.xfam.org/family/PF01023", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P50543", "url": "http://purl.obolibrary.org/obo/PR_P50543", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_058020", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P50543-1", "url": "https://www.uniprot.org/uniprot/P50543-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI", "length": 98, "header": "sp|P50543-1|S10AB_MOUSE Isoform 1 of Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1 CANONICAL=P50543-1" }, "isoforms": [ { "isoform_ac": "P50543-1", "url": "", "sequence": { "sequence": "MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI", "length": 98, "header": "sp|P50543-1|S10AB_MOUSE Isoform 1 of Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1 CANONICAL=P50543-1" }, "locus": { "chromosome": "3", "start_pos": 93433451, "end_pos": 93431366, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000029515", "url": "https://www.ensembl.org/id/ENSMUST00000029515" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000029515", "url": "https://www.ensembl.org/id/ENSMUSP00000029515" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" }, { "database": "PRO", "id": "P50543", "url": "http://purl.obolibrary.org/obo/P50543" }, { "database": "iPTMnet", "id": "P50543", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P50543" } ], "site_lbl": "Thr5" } ], "glycation": [], "keywords": [], "publication": [ { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Alarmin S100A11 initiates a chemokine response to the human pathogen Toxoplasma gondii.", "journal": "Nature immunology", "date": "2019", "authors": "Safronova A, Araujo A, Camanzo ET, Moon TJ, Elliott MR, Beiting DP, Yarovinsky F", "evidence": [ { "database": "RefSeq", "id": "NP_058020", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020" } ], "reference": [ { "type": "PubMed", "id": "30455460", "url": "https://glygen.org/publication/PubMed/30455460" } ] }, { "title": "S100A11 Promotes Liver Steatosis via FOXO1-Mediated Autophagy and Lipogenesis.", "journal": "Cellular and molecular gastroenterology and hepatology", "date": "2021", "authors": "Zhang L, Zhang Z, Li C, Zhu T, Gao J, Zhou H, Zheng Y, Chang Q, Wang M, Wu J, Ran L, Wu Y, Miao H, Zou X, Liang B", "evidence": [ { "database": "RefSeq", "id": "NP_058020", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020" } ], "reference": [ { "type": "PubMed", "id": "33075563", "url": "https://glygen.org/publication/PubMed/33075563" } ] }, { "title": "Dicalcin suppresses in vitro trophoblast attachment in human cell lines.", "journal": "Biochemical and biophysical research communications", "date": "2021", "authors": "Saito R, Satoh H, Aoba K, Hirasawa H, Miwa N", "evidence": [ { "database": "RefSeq", "id": "NP_058020", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058020" } ], "reference": [ { "type": "PubMed", "id": "34311201", "url": "https://glygen.org/publication/PubMed/34311201" } ] } ], "pathway": [ { "id": "mmu:20195", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:20195", "resource": "KEGG Pathway" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P31949-1", "protein_name": "Protein S100-A11", "gene_name": "S100A11", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT", "length": 105 }, "evidence": [ { "id": "45229095", "url": "http://www.informatics.jax.org/homology/45229095", "database": "MGI" }, { "id": "P50543", "url": "https://omabrowser.org/oma/group/P50543/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6B345-1", "protein_name": "Protein S100-A11", "gene_name": "S100a11", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPTETERCIESLIAVFQKYSGKDGNSCHLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAIACHESFLQTSQKRI", "length": 98 }, "evidence": [ { "id": "45229095", "url": "http://www.informatics.jax.org/homology/45229095", "database": "MGI" }, { "id": "P50543", "url": "https://omabrowser.org/oma/group/P50543/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" }, { "name": "ruffle", "id": "GO:0001726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001726", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "regulation of cell population proliferation", "id": "GO:0042127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell migration", "id": "GO:0014911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014911", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" }, { "name": "calcium-dependent protein binding", "id": "GO:0048306", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048306", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" }, { "name": "S100 protein binding", "id": "GO:0044548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044548", "evidence": [ { "database": "UniProtKB", "id": "P50543", "url": "https://www.uniprot.org/uniprot/P50543" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 25, "end_pos": 27, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }