{
    "uniprot_canonical_ac": "P50518-1",
    "uniprot_ac": "P50518",
    "uniprot_id": "VATE1_MOUSE",
    "mass": {
        "chemical_mass": 26157.0,
        "monoisotopic_mass": 26157.0
    },
    "refseq": {
        "ac": "NP_031536",
        "name": "V-type proton ATPase subunit E 1",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031536"
    },
    "gene_names": [
        {
            "name": "Atp6v1e1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P50518",
            "id": "P50518"
        },
        {
            "name": "2410029D23Rik; Atp6e; Atp6e2; Atp6v1e; D6Ertd385e; p31; Vma4",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031536",
            "id": "NP_031536"
        },
        {
            "name": "Atp6e2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P50518",
            "id": "P50518"
        },
        {
            "name": "Atp6e",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P50518",
            "id": "P50518"
        },
        {
            "name": "Atp6v1e1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031536",
            "id": "NP_031536"
        }
    ],
    "protein_names": [
        {
            "name": "V-type proton ATPase subunit E 1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P50518"
        },
        {
            "name": "ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E; V-ATPase subunit E 1; V-ATPase 31 kDa subunit; vacuolar proton pump subunit E 1; VATPase, H+ transporting, lysosomal V1 subunit E1; H(+)-ATPase E-like protein",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031536",
            "id": "NP_031536"
        },
        {
            "name": "V-ATPase 31 kDa subunit",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P50518"
        },
        {
            "name": "V-ATPase subunit E 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P50518"
        },
        {
            "name": "V-type proton ATPase subunit E 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031536",
            "id": "NP_031536"
        },
        {
            "name": "Vacuolar proton pump subunit E 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P50518"
        },
        {
            "name": "p31",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P50518"
        }
    ],
    "function": [
        {
            "annotation": "In pancreatic intraepithelial lesions, V1E subunits localized to the basolateral domain in specific regions. Blocking the v-ATPase disrupted Wnt/beta-catenin signaling in primary PanIN cells.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_031536",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031536"
                },
                {
                    "database": "PubMed",
                    "id": "25072283",
                    "url": "https://glygen.org/publication/PubMed/25072283"
                }
            ]
        },
        {
            "annotation": "Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (By similarity). V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment (By similarity).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P50518",
                    "url": "https://www.uniprot.org/uniprot/P50518#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "P36543",
                    "url": "https://www.uniprot.org/uniprot/P36543#function"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0070140",
            "recommended_name": {
                "id": "DOID:0070140",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0070140",
                "name": "autosomal recessive cutis laxa type IIC",
                "description": "An autosomal recessive cutis laxa type II classic type characterized by cardiovascular involvement that has_material_basis_in homozygous mutation in the ATP6V1E1 gene on chromosome 22q11."
            },
            "synonyms": [
                {
                    "id": "MONDO:0027462",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0027462",
                    "name": "autosomal recessive cutis laxa type 2C",
                    "description": "An autosomal recessive cutis laxa type II classic type characterized by cardiovascular involvement that has material basis in homozygous mutation in the ATP6V1E1 gene on chromosome 22q11."
                },
                {
                    "id": "MONDO:0027462",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0027462",
                    "name": "ARCL2C",
                    "description": ""
                },
                {
                    "id": "MONDO:0027462",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0027462",
                    "name": "autosomal recessive cutis laxa type IIC",
                    "description": ""
                },
                {
                    "id": "MONDO:0027462",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0027462",
                    "name": "cutis laxa, autosomal recessive, type 2C",
                    "description": ""
                },
                {
                    "id": "MONDO:0027462",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0027462",
                    "name": "cutis laxa, autosomal recessive, type IIC",
                    "description": ""
                },
                {
                    "id": "MIM:617402",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/617402",
                    "name": "Cutis laxa, autosomal recessive, 2C",
                    "description": "Cutis laxa, autosomal recessive, 2C"
                }
            ],
            "evidence": [
                {
                    "id": "0070140",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0070140"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P50518",
                    "url": "https://www.uniprot.org/uniprot/P50518"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Atp6v1e1",
            "url": "https://www.uniprot.org/uniprot/P50518",
            "locus": {
                "chromosome": "6",
                "start_pos": 120771266,
                "end_pos": 120799754,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000019210",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000019210"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000019210",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000019210",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "11973",
            "url": "https://www.ncbi.nlm.nih.gov/gene/11973",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "P50518",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P50518*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR002842",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002842",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR038495",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR038495",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:11973",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:11973",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "894326",
            "url": "http://www.informatics.jax.org/marker/MGI:894326",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P50518",
            "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P50518",
            "database": "O-GlcNAc Database",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "RIVVRCR",
            "url": "https://omabrowser.org/oma/group/RIVVRCR/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5397689at2759",
            "url": "http://www.orthodb.org/?query=5397689at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR45715",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45715",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR45715:SF2",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45715:SF2",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF01991",
            "url": "http://pfam.xfam.org/family/PF01991",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P50518",
            "url": "http://purl.obolibrary.org/obo/PR_P50518",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-1222556",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1222556",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-MMU-77387",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-77387",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-MMU-917977",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-917977",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-MMU-9639288",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9639288",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-MMU-983712",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983712",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_031536",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031536",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0N4SW07",
            "url": "https://www.uniprot.org/uniprot/A0A0N4SW07",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0N4SW07-1",
            "url": "https://www.uniprot.org/uniprot/A0A0N4SW07-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0N4SW34",
            "url": "https://www.uniprot.org/uniprot/A0A0N4SW34",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0N4SW34-1",
            "url": "https://www.uniprot.org/uniprot/A0A0N4SW34-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0N4SWA3",
            "url": "https://www.uniprot.org/uniprot/A0A0N4SWA3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0N4SWA3-1",
            "url": "https://www.uniprot.org/uniprot/A0A0N4SWA3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P50518",
            "url": "https://www.uniprot.org/uniprot/P50518",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P50518-1",
            "url": "https://www.uniprot.org/uniprot/P50518-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD",
        "length": 226,
        "header": "sp|P50518-1|VATE1_MOUSE Isoform 1 of V-type proton ATPase subunit E 1  OS=Mus musculus OX=10090 GN=Atp6v1e1 PE=1 SV=2 CANONICAL=P50518-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A0N4SW07-1",
            "url": "",
            "sequence": {
                "sequence": "IKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLMMPEVRGALFGANANRKFLD",
                "length": 128,
                "header": "tr|A0A0N4SW07-1|A0A0N4SW07_MOUSE Computationally mapped isoform of ATPase, H+ transporting, lysosomal V1 subunit E1  OS=Mus musculus OX=10090 GN=Atp6v1e1 PE=1 SV=1 CANONICAL=P50518-1"
            },
            "locus": {
                "chromosome": "6",
                "start_pos": 120795360,
                "end_pos": 120772666,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000203783.3",
                        "url": "https://www.ensembl.org/id/ENSMUST00000203783.3"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000145324.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000145324.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A0N4SW34-1",
            "url": "",
            "sequence": {
                "sequence": "MALSDADVQKQAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDT",
                "length": 87,
                "header": "tr|A0A0N4SW34-1|A0A0N4SW34_MOUSE Computationally mapped isoform of ATPase, H+ transporting, lysosomal V1 subunit E1  OS=Mus musculus OX=10090 GN=Atp6v1e1 PE=1 SV=1 CANONICAL=P50518-1"
            },
            "locus": {
                "chromosome": "6",
                "start_pos": 120799581,
                "end_pos": 120781043,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000205049.3",
                        "url": "https://www.ensembl.org/id/ENSMUST00000205049.3"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000145353.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000145353.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A0N4SWA3-1",
            "url": "",
            "sequence": {
                "sequence": "MMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLIT",
                "length": 78,
                "header": "tr|A0A0N4SWA3-1|A0A0N4SWA3_MOUSE Computationally mapped isoform of ATPase, H+ transporting, lysosomal V1 subunit E1  OS=Mus musculus OX=10090 GN=Atp6v1e1 PE=1 SV=1 CANONICAL=P50518-1"
            },
            "locus": {
                "chromosome": "6",
                "start_pos": 120795351,
                "end_pos": 120784547,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000204699.2",
                        "url": "https://www.ensembl.org/id/ENSMUST00000204699.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000145437.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000145437.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "P50518-1",
            "url": "",
            "sequence": {
                "sequence": "MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD",
                "length": 226,
                "header": "sp|P50518-1|VATE1_MOUSE Isoform 1 of V-type proton ATPase subunit E 1  OS=Mus musculus OX=10090 GN=Atp6v1e1 PE=1 SV=2 CANONICAL=P50518-1"
            },
            "locus": {
                "chromosome": "6",
                "start_pos": 120799581,
                "end_pos": 120772666,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000019354",
                        "url": "https://www.ensembl.org/id/ENSMUST00000019354"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000019354",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000019354"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "G49108TO",
            "type": "O-linked",
            "subtype": "O-GlcNAcylation",
            "site_category": "reported_with_glycan",
            "site_seq": "",
            "relation": "attached",
            "comment": "O-GlcNAcylation",
            "evidence": [
                {
                    "id": "P50518",
                    "database": "O-GlcNAc Database",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P50518"
                },
                {
                    "id": "33300544",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/33300544"
                }
            ]
        }
    ],
    "phosphorylation": [
        {
            "start_pos": 56,
            "end_pos": 56,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P50518",
                    "url": "https://www.uniprot.org/uniprot/P50518"
                },
                {
                    "database": "PubMed",
                    "id": "18034455",
                    "url": "https://glygen.org/publication/PubMed/18034455"
                },
                {
                    "database": "iPTMnet",
                    "id": "P50518",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P50518"
                }
            ],
            "site_lbl": "Tyr56"
        }
    ],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_reported_with_glycan"
    ],
    "publication": [
        {
            "title": "A proton pump ATPase with testis-specific E1-subunit isoform required for acrosome acidification.",
            "journal": "J. Biol. Chem.",
            "date": "2002",
            "authors": "Sun-Wada GH, Imai-Senga Y, Yamamoto A, Murata Y, Hirata T, Wada Y, Futai M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P50518",
                    "url": "https://www.uniprot.org/uniprot/P50518"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11872743",
                    "url": "https://glygen.org/publication/PubMed/11872743"
                }
            ]
        },
        {
            "title": "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain.",
            "journal": "Journal of proteome research",
            "date": "2008",
            "authors": "Ballif BA, Carey GR, Sunyaev SR, Gygi SP",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P50518",
                    "url": "https://www.uniprot.org/uniprot/P50518"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0N4SW34",
                    "url": "https://www.uniprot.org/uniprot/A0A0N4SW34"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0N4SW07",
                    "url": "https://www.uniprot.org/uniprot/A0A0N4SW07"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0N4SWA3",
                    "url": "https://www.uniprot.org/uniprot/A0A0N4SWA3"
                },
                {
                    "database": "iPTMnet",
                    "id": "P50518",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P50518"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18034455",
                    "url": "https://glygen.org/publication/PubMed/18034455"
                }
            ]
        },
        {
            "title": "RAB-like 2 has an essential role in male fertility, sperm intra-flagellar transport, and tail assembly.",
            "journal": "PLoS Genet.",
            "date": "2012",
            "authors": "Lo JC, Jamsai D, O'Connor AE, Borg C, Clark BJ, Whisstock JC, Field MC, Adams V, Ishikawa T, Aitken RJ, Whittle B, Goodnow CC, Ormandy CJ, O'Bryan MK",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P50518",
                    "url": "https://www.uniprot.org/uniprot/P50518"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23055941",
                    "url": "https://glygen.org/publication/PubMed/23055941"
                }
            ]
        },
        {
            "title": "Polarization of the vacuolar adenosine triphosphatase delineates a transition to high-grade pancreatic intraepithelial neoplasm lesions.",
            "journal": "Pancreas",
            "date": "2014",
            "authors": "Sreekumar BK, Belinsky GS, Einwachter H, Rhim AD, Schmid R, Chung C",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_031536",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031536"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25072283",
                    "url": "https://glygen.org/publication/PubMed/25072283"
                }
            ]
        },
        {
            "title": "H+-ATPase B1 subunit localizes to thick ascending limb and distal convoluted tubule of rodent and human kidney.",
            "journal": "Am. J. Physiol.",
            "date": "2018",
            "authors": "Frische S, Chambrey R, Trepiccione F, Zamani R, Marcussen N, Alexander RT, Skjodt K, Svenningsen P, Dimke H",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P50518",
                    "url": "https://www.uniprot.org/uniprot/P50518"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29993276",
                    "url": "https://glygen.org/publication/PubMed/29993276"
                }
            ]
        },
        {
            "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.",
            "journal": "Brain : a journal of neurology",
            "date": "2020",
            "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI",
            "evidence": [
                {
                    "database": "O-GlcNAc Database",
                    "id": "P50518",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P50518"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "33300544",
                    "url": "https://glygen.org/publication/PubMed/33300544"
                }
            ]
        },
        {
            "title": "Resorption-cycle-dependent polarization of mRNAs for different subunits of V-ATPase in bone-resorbing osteoclasts.",
            "journal": "Mol. Biol. Cell",
            "date": "1996",
            "authors": "Laitala-Leinonen T, Howell ML, Dean GE, Vaananen HK",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P50518",
                    "url": "https://www.uniprot.org/uniprot/P50518"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8741845",
                    "url": "https://glygen.org/publication/PubMed/8741845"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:11973",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:11973",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-1222556",
            "name": "ROS and RNS production in phagocytes",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1222556",
            "resource": "Reactome",
            "description": "ROS and RNS production in phagocytes"
        },
        {
            "id": "R-MMU-77387",
            "name": "Insulin receptor recycling",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-77387",
            "resource": "Reactome",
            "description": "Insulin receptor recycling"
        },
        {
            "id": "R-MMU-917977",
            "name": "Transferrin endocytosis and recycling",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-917977",
            "resource": "Reactome",
            "description": "Transferrin endocytosis and recycling"
        },
        {
            "id": "R-MMU-9639288",
            "name": "Amino acids regulate mTORC1",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9639288",
            "resource": "Reactome",
            "description": "Amino acids regulate mTORC1"
        },
        {
            "id": "R-MMU-983712",
            "name": "Ion channel transport",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983712",
            "resource": "Reactome",
            "description": "Ion channel transport"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P22203-1",
            "protein_name": "V-type proton ATPase subunit E",
            "gene_name": "VMA4",
            "tax_id": 559292,
            "organism": "Saccharomyces cerevisiae S288C",
            "sequence": {
                "sequence": "MSSAITALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYEIEKTNIVRNETNNIDGNFKSKLKKAMLSQQITKSTIANKMRLKVLSAREQSLDGIFEETKEKLSGIANNRDEYKPILQSLIVEALLKLLEPKAIVKALERDVDLIESMKDDIMREYGEKAQRAPLEEIVISNDYLNKDLVSGGVVVSNASDKIEINNTLEERLKLLSEEALPAIRLELYGPSKTRKFFD",
                "length": 233
            },
            "evidence": [
                {
                    "id": "P50518",
                    "url": "https://omabrowser.org/oma/group/P50518/",
                    "database": "OMA"
                }
            ],
            "common_name": "Yeast"
        },
        {
            "uniprot_canonical_ac": "P36543-1",
            "protein_name": "V-type proton ATPase subunit E 1",
            "gene_name": "ATP6V1E1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD",
                "length": 226
            },
            "evidence": [
                {
                    "id": "45224120",
                    "url": "http://www.informatics.jax.org/homology/45224120",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "P54611-1",
            "protein_name": "V-type proton ATPase subunit E",
            "gene_name": "Vha26",
            "tax_id": 7227,
            "organism": "Drosophila melanogaster",
            "sequence": {
                "sequence": "MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNTLESRLDLISQQLVPEIRNALFGRNVNRKFTD",
                "length": 226
            },
            "evidence": [
                {
                    "id": "P50518",
                    "url": "https://omabrowser.org/oma/group/P50518/",
                    "database": "OMA"
                }
            ],
            "common_name": "Fruit fly"
        },
        {
            "uniprot_canonical_ac": "Q6PCU2-1",
            "protein_name": "V-type proton ATPase subunit E 1",
            "gene_name": "Atp6v1e1",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDLEAYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD",
                "length": 226
            },
            "evidence": [
                {
                    "id": "45224120",
                    "url": "http://www.informatics.jax.org/homology/45224120",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 10,
                "go_terms": [
                    {
                        "name": "extrinsic component of synaptic vesicle membrane",
                        "id": "GO:0098850",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098850",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mitochondrion",
                        "id": "GO:0005739",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "endosome",
                        "id": "GO:0005768",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytosol",
                        "id": "GO:0005829",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "apical plasma membrane",
                        "id": "GO:0016324",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "clathrin-coated vesicle membrane",
                        "id": "GO:0030665",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030665",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "microvillus",
                        "id": "GO:0005902",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005902",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "vacuolar proton-transporting V-type ATPase, V1 domain",
                        "id": "GO:0000221",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000221",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "proton-transporting two-sector ATPase complex, catalytic domain",
                        "id": "GO:0033178",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033178",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "ATPase binding",
                        "id": "GO:0051117",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051117",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "proton-transporting ATPase activity, rotational mechanism",
                        "id": "GO:0046961",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046961",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "synaptic vesicle lumen acidification",
                        "id": "GO:0097401",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097401",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "proton transmembrane transport",
                        "id": "GO:1902600",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902600",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P50518",
                                "url": "https://www.uniprot.org/uniprot/P50518"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment"
            ]
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}