{ "uniprot_canonical_ac": "P50430-1", "uniprot_ac": "P50430", "uniprot_id": "ARSB_RAT", "mass": { "chemical_mass": 58959.0, "monoisotopic_mass": 58959.0 }, "refseq": { "ac": "NP_254278", "name": "arylsulfatase B precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_254278" }, "gene_names": [ { "name": "Arsb", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P50430", "id": "P50430" }, { "name": "Arsb", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_254278", "id": "NP_254278" } ], "protein_names": [ { "name": "Arylsulfatase B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P50430" }, { "name": "3.1.6.12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P50430" }, { "name": "ASB; G4S; N-acetylgalactosamine-4-sulfatase; Arylsulfatase B (MPS VI)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_254278", "id": "NP_254278" }, { "name": "ASB", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P50430" }, { "name": "G4S", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P50430" }, { "name": "N-acetylgalactosamine-4-sulfatase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P50430" }, { "name": "arylsulfatase B precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_254278", "id": "NP_254278" } ], "function": [ { "annotation": "Removes sulfate groups from chondroitin-4-sulfate (C4S) and regulates its degradation (PubMed:24311516). In the central nervous system, is a regulator of neurite outgrowth and neuronal plasticity, acting through the control of sulfate glycosaminoglycans and neurocan levels (PubMed:24311516). Involved in the regulation of cell adhesion, cell migration and invasion in colonic epithelium (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430#function" }, { "database": "UniProtKB", "id": "P15848", "url": "https://www.uniprot.org/uniprot/P15848#function" }, { "database": "PubMed", "id": "24311516", "url": "https://glygen.org/publication/PubMed/24311516" } ] } ], "disease": [ { "disease_id": "DOID:12800", "recommended_name": { "id": "DOID:12800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12800", "name": "mucopolysaccharidosis VI", "description": "A mucopolysaccharidosis characterized by a deficiency of the lysosomal enzyme N-acetylgalactosamine 4-sulfatase." }, "synonyms": [ { "id": "DOID:12800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12800", "name": "MPS VI - Maroteaux-Lamy syndrome", "description": "" }, { "id": "DOID:12800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12800", "name": "Maroteaux - Lamy syndrome", "description": "" }, { "id": "DOID:12800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12800", "name": "Maroteaux-Lamy syndrome", "description": "" }, { "id": "DOID:12800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12800", "name": "arylsulfatase B deficiency", "description": "" }, { "id": "DOID:12800", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12800", "name": "deficiency of N-acetylgalactosamine-4-sulfatase", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "mucopolysaccharidosis type 6", "description": "Mucopolysaccharidosis type 6 (MPS 6) is a lysosomal storage disease with progressive multisystem involvement, associated with a deficiency of arylsulfatase B (ASB) leading to the accumulation of dermatan sulfate." }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "ARSB deficiency", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "ASB deficiency", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "MPS VI - Maroteaux-Lamy syndrome", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "MPS6", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "MPSVI", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "Maroteaux - Lamy syndrome", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "Maroteaux-Lamy disease", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "Maroteaux-Lamy syndrome", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "N-acetylgalactosamine 4-sulfatase deficiency", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "arylsulfatase B deficiency", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "deficiency of N-acetylgalactosamine-4-sulfatase", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "mucopolysaccharidosis type VI", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "mucopolysaccharidosis type VI (Maroteaux-Lamy)", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "Arsb deficiency", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "MPS 6", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "MPS VI", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "Maroteaux Lamy syndrome", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "Mucopoly-saccharidosis type VI", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "N-acetylgalactosamine-4-sulfatase deficiency", "description": "" }, { "id": "MONDO:0009661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009661", "name": "mucopolysaccharidosis VI", "description": "" }, { "id": "MIM:253200", "resource": "MIM", "url": "https://www.omim.org/entry/253200", "name": "Mucopolysaccharidosis 6", "description": "Mucopolysaccharidosis 6" } ], "evidence": [ { "id": "12800", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12800" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "common_name": "Rat" } ], "gene": [ { "name": "Arsb", "url": "https://www.uniprot.org/uniprot/P50430", "locus": { "chromosome": "2", "start_pos": 25162671, "end_pos": 25002346, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000011150", "url": "https://www.ensembl.org/id/ENSRNOG00000011150" } ] } } ], "crossref": [ { "id": "ENSRNOG00000011150", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000011150", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.1.6.12", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.6.12&UniProtAcc=P50430", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "3.1.6.4", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.6.4&UniProtAcc=P50430", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd16029", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16029", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "25227", "url": "https://www.ncbi.nlm.nih.gov/gene/25227", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P50430", "url": "https://www.ebi.ac.uk/intact/interactors/id:P50430*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000917", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000917", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024607", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024607", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047115", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047115", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:25227", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:25227", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HEHCVFI", "url": "https://omabrowser.org/oma/group/HEHCVFI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2913702at2759", "url": "http://www.orthodb.org/?query=2913702at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10342", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10342", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10342:SF272", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10342:SF272", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00884", "url": "http://pfam.xfam.org/family/PF00884", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P50430", "url": "http://purl.obolibrary.org/obo/PR_P50430", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-1663150", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1663150", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2024101", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9840310", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_254278", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_254278", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2158", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2158", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P50430-1", "url": "https://www.uniprot.org/uniprot/P50430-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGELSGCTGGSRAGGPGPRLPLLLLLLLWPARASDAAPPPHVVFVLADDLGWNDLGFHGSVIRTPHLDALAAGGVVLDNYYVQPLCTPSRSQLLTGRYQIHMGLQHYLIMTCQPNCVPLDEKLLPQLLKDAGYATHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYTHEACAPIECLNGTRCALDLRDGEEPAKEYTDIYSTNIFTKRATTLIANHPPEKPLFLYLAFQSVHDPLQVPEEYMEPYDFIQDKHRRIYAGMVSLLDEAVGNVTKALKSRGLWNNTVLIFSTDNGGQTRSGGNNWPLRGRKGTLWEGGIRGAGFVASPLLKQKGVKSRELMHITDWLPTLVNLAGGSTHGTKPLDGFDVWETISEGSPSPRVELLLNIDPDFFDGLPCPGKNTTPEKNDSFPLEHSAFNTSIHAGIRYKNWKLLTGYPGCGYWFPPPSQSNISEVPSVDSPTKTLWLFDINRDPEERHDVSREHPHIVQNLLSRLQYYHEHSVPSYFPPLDPRCDPKGTGVWSPWM", "length": 528, "header": "sp|P50430-1|ARSB_RAT Isoform 1 of Arylsulfatase B OS=Rattus norvegicus OX=10116 GN=Arsb PE=2 SV=2 CANONICAL=P50430-1" }, "isoforms": [ { "isoform_ac": "P50430-1", "url": "", "sequence": { "sequence": "MGELSGCTGGSRAGGPGPRLPLLLLLLLWPARASDAAPPPHVVFVLADDLGWNDLGFHGSVIRTPHLDALAAGGVVLDNYYVQPLCTPSRSQLLTGRYQIHMGLQHYLIMTCQPNCVPLDEKLLPQLLKDAGYATHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYTHEACAPIECLNGTRCALDLRDGEEPAKEYTDIYSTNIFTKRATTLIANHPPEKPLFLYLAFQSVHDPLQVPEEYMEPYDFIQDKHRRIYAGMVSLLDEAVGNVTKALKSRGLWNNTVLIFSTDNGGQTRSGGNNWPLRGRKGTLWEGGIRGAGFVASPLLKQKGVKSRELMHITDWLPTLVNLAGGSTHGTKPLDGFDVWETISEGSPSPRVELLLNIDPDFFDGLPCPGKNTTPEKNDSFPLEHSAFNTSIHAGIRYKNWKLLTGYPGCGYWFPPPSQSNISEVPSVDSPTKTLWLFDINRDPEERHDVSREHPHIVQNLLSRLQYYHEHSVPSYFPPLDPRCDPKGTGVWSPWM", "length": 528, "header": "sp|P50430-1|ARSB_RAT Isoform 1 of Arylsulfatase B OS=Rattus norvegicus OX=10116 GN=Arsb PE=2 SV=2 CANONICAL=P50430-1" }, "locus": { "chromosome": "2", "start_pos": 25160556, "end_pos": 25002427, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000014860", "url": "https://www.ensembl.org/id/ENSRNOT00000014860" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000014860", "url": "https://www.ensembl.org/id/ENSRNOP00000014860" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 183, "start_aa": "Asn", "end_pos": 183, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn183", "evidence": [ { "id": "P50430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50430#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 274, "start_aa": "Asn", "end_pos": 274, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn274", "evidence": [ { "id": "P50430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50430#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 286, "start_aa": "Asn", "end_pos": 286, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn286", "evidence": [ { "id": "P50430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50430#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 410, "start_aa": "Asn", "end_pos": 410, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn410", "evidence": [ { "id": "P50430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50430#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 421, "start_aa": "Asn", "end_pos": 421, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn421", "evidence": [ { "id": "P50430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50430#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P50430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50430#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship.", "journal": "Hum. Mol. Genet.", "date": "2005", "authors": "Ballabio A., Annunziata I., Roma G., Sardiello M.", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "reference": [ { "type": "PubMed", "id": "16174644", "url": "https://glygen.org/publication/PubMed/16174644" } ] }, { "title": "Cell-surface arylsulfatase A and B on sinusoidal endothelial cells, hepatocytes, and Kupffer cells in mammalian livers.", "journal": "Med. Mol. Morphol.", "date": "2009", "authors": "Kawakami H., Kusunoki S., Akimoto Y., Akasaka K., Mitsunaga-Nakatsubo K.", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "reference": [ { "type": "PubMed", "id": "19536613", "url": "https://glygen.org/publication/PubMed/19536613" } ] }, { "title": "Arylsulfatase B modulates neurite outgrowth via astrocyte chondroitin-4-sulfate: dysregulation by ethanol.", "journal": "Glia", "date": "2014", "authors": "Zhang X, Bhattacharyya S, Kusumo H, Goodlett CR, Tobacman JK, Guizzetti M", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "reference": [ { "type": "PubMed", "id": "24311516", "url": "https://glygen.org/publication/PubMed/24311516" } ] }, { "title": "Mucopolysaccharidosis type VI in rats: isolation of cDNAs encoding arylsulfatase B, chromosomal localization of the gene, and identification of the mutation.", "journal": "Genomics", "date": "1995", "authors": "Kunieda T.", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "reference": [ { "type": "PubMed", "id": "8575749", "url": "https://glygen.org/publication/PubMed/8575749" } ] } ], "pathway": [ { "id": "rno:25227", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:25227", "resource": "KEGG Pathway" }, { "id": "R-RNO-1663150", "name": "The activation of arylsulfatases", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1663150", "resource": "Reactome", "description": "The activation of arylsulfatases" }, { "id": "R-RNO-2024101", "name": "CS/DS degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2024101", "resource": "Reactome", "description": "CS/DS degradation" }, { "id": "R-RNO-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-RNO-9840310", "name": "Glycosphingolipid catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9840310", "resource": "Reactome", "description": "Glycosphingolipid catabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "P15848-1", "protein_name": "Arylsulfatase B", "gene_name": "ARSB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM", "length": 533 }, "evidence": [ { "id": "45231384", "url": "http://www.informatics.jax.org/homology/45231384", "database": "MGI" }, { "id": "P50430", "url": "https://omabrowser.org/oma/group/P50430/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P50429-1", "protein_name": "Arylsulfatase B", "gene_name": "Arsb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGKLSPCTGRSRPGGPGPQLPLLLLLLQLLLLLLSPARASGATQPPHVVFVLADDLGWNDLGFHGSVIRTPHLDALAAGGVVLDNYYVQPLCTPSRSQLLTGRYQIHLGLQHYLIMTCQPSCVPLDEKLLPQLLKEAGYATHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYTHEACAPIESLNGTRCALDLRDGEEPAKEYNNIYSTNIFTKRATTVIANHPPEKPLFLYLAFQSVHDPLQVPEEYMEPYGFIQDKHRRIYAGMVSLMDEAVGNVTKALKSHGLWNNTVFIFSTDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELMHITDWLPTLVDLAGGSTNGTKPLDGFNMWKTISEGHPSPRVELLHNIDQDFFDGLPCPGKNMTPAKDDSFPLEHSAFNTSIHAGIRYKNWKLLTGHPGCGYWFPPPSQSNVSEIPPVGPPTKTLWLFDINQDPEERHDVSREHPHIVQNLLSRLQYYHEHSVPSHFPPLDPRCDPKSTGVWSPWM", "length": 534 }, "evidence": [ { "id": "45231384", "url": "http://www.informatics.jax.org/homology/45231384", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "N-acetylgalactosamine-6-sulfatase activity", "id": "GO:0043890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043890", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "arylsulfatase activity", "id": "GO:0004065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004065", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "N-acetylgalactosamine-4-sulfatase activity", "id": "GO:0003943", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003943", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "sulfuric ester hydrolase activity", "id": "GO:0008484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008484", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "dermatan sulfate catabolic process", "id": "GO:0030209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030209", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "response to nutrient", "id": "GO:0007584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007584", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "positive regulation of neuron projection development", "id": "GO:0010976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010976", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "autophagy", "id": "GO:0006914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006914", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "response to pH", "id": "GO:0009268", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009268", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "response to estrogen", "id": "GO:0043627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043627", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "response to methylmercury", "id": "GO:0051597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051597", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "regulation of epithelial cell migration", "id": "GO:0010632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010632", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "colon epithelial cell migration", "id": "GO:0061580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061580", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "anterior head development", "id": "GO:0097065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097065", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "P50430", "url": "https://www.uniprot.org/uniprot/P50430" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 183, "end_pos": 185, "annotation": "n_glycosylation_sequon" }, { "start_pos": 274, "end_pos": 276, "annotation": "n_glycosylation_sequon" }, { "start_pos": 286, "end_pos": 288, "annotation": "n_glycosylation_sequon" }, { "start_pos": 404, "end_pos": 406, "annotation": "n_glycosylation_sequon" }, { "start_pos": 410, "end_pos": 412, "annotation": "n_glycosylation_sequon" }, { "start_pos": 421, "end_pos": 423, "annotation": "n_glycosylation_sequon" }, { "start_pos": 453, "end_pos": 455, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-1606789", "name": "ARSB hydrolyses DS", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [ "R-ALL-2065231" ], "output_participant_list": [ "R-ALL-1606845", "R-ALL-2065213" ], "enzyme_list": [ "P50430-1" ], "evidence": [ { "id": "R-RNO-1606789", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1606789" } ] }, { "id": "R-RNO-1614362", "name": "SUMF1 mediates the oxidation of cysteine to formylglycine, producing active arylsulfatases", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen", "input_participant_list": [], "output_participant_list": [ "R-ALL-1663154" ], "enzyme_list": [ "P50430-1", "P15589-1", "Q32KJ2-1", "Q32KJ8-1", "Q32KJ9-1", "Q32KK0-1" ], "evidence": [ { "id": "R-RNO-1614362", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1614362" } ] }, { "id": "R-RNO-1793207", "name": "ARSB hydrolyses C4S/C6S chains", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [], "output_participant_list": [ "R-ALL-2065239" ], "enzyme_list": [ "P50430-1" ], "evidence": [ { "id": "R-RNO-1793207", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1793207" } ] }, { "id": "R-RNO-6798751", "name": "Exocytosis of azurophil granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, azurophil granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q3MIE4-1", "P09215-1", "P63086-1", "O35244-1", "P16638-1", "P50430-1", "P53534-1", "P46462-1", "D3ZZC1-1", "Q32KJ5-1", "D3ZUM4-1", "P06760-1", "P07824-1", "P30919-1", "P80067-1", "D3ZLZ7-1", "P00697-1", "P20070-1", "P20717-1", "Q6XQN1-1", "D4AE56-1", "P70709-1", "Q62662-1", "Q66H71-1", "Q6AYS4-1", "P00762-1", "P00763-1", "P17164-1", "Q62867-1", "Q9EPB1-1", "Q32KJ6-1", "Q6AXR4-1", "D3ZJF9-1" ], "evidence": [ { "id": "R-RNO-6798751", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798751" } ] }, { "id": "R-RNO-6800434", "name": "Exocytosis of ficolin-rich granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, ficolin-1-rich granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P82995-1", "P05197-1", "Q8K4Y7-1", "P63018-1", "P63086-1", "P38652-1", "P09811-1", "P16638-1", "P05065-1", "P50430-1", "Q6P6V0-1", "P97571-1", "P46462-1", "P09117-1", "D4AEH9-1", "F1M1H0-1", "F7FLB2-1", "Q32KJ5-1", "P50282-1", "D3ZUM4-1", "P00787-1", "P04762-1", "P06760-1", "P24268-1", "P32038-1", "Q6P7S1-1", "D3ZLZ7-1", "E9PU28-1", "P19804-1", "P27926-1", "P30349-1", "P41562-1", "D4AC85-1", "M0RD14-1", "D4ADE8-1", "D4AC20-1", "O09178-1", "P13676-1", "P19132-1", "P62630-1", "P10111-1", "P25113-1", "P30835-1", "P85973-1", "Q9JHW0-1", "Q9Z0V5-1", "Q02765-1", "Q9R1T3-1", "O35264-1", "P12527-1", "O08730-1", "P04906-1", "P06214-1", "P30904-1", "P70618-1" ], "evidence": [ { "id": "R-RNO-6800434", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6800434" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1606845", "participant_name": "SO4(2-) [lysosomal lumen]", "crossref": [ { "id": "16189", "database": "ChEBI", "url": "" }, { "id": "C00059", "database": "COMPOUND", "url": "" }, { "id": "8144977", "database": "PubChem Substance", "url": "" }, { "id": "16189", "database": "ChEBI", "url": "" }, { "id": "C00059", "database": "COMPOUND", "url": "" }, { "id": "8144977", "database": "PubChem Substance", "url": "" }, { "id": "8144977", "database": "PubChem Substance", "url": "" }, { "id": "16189", "database": "ChEBI", "url": "" }, { "id": "C00059", "database": "COMPOUND", "url": "" }, { "id": "16189", "database": "ChEBI", "url": "" }, { "id": "C00059", "database": "COMPOUND", "url": "" }, { "id": "8144977", "database": "PubChem Substance", "url": "" } ] }, { "participant_id": "R-ALL-1663154", "participant_name": "H2S [endoplasmic reticulum lumen]", "crossref": [ { "id": "29919", "database": "ChEBI", "url": "" }, { "id": "29919", "database": "ChEBI", "url": "" }, { "id": "29919", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2065213", "participant_name": "ChEBI:63517 chain [lysosomal lumen]", "crossref": [ { "id": "63517", "database": "ChEBI", "url": "" }, { "id": "63517", "database": "ChEBI", "url": "" }, { "id": "63517", "database": "ChEBI", "url": "" }, { "id": "63517", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2065231", "participant_name": "ChEBI:63519 chain [lysosomal lumen]", "crossref": [ { "id": "63519", "database": "ChEBI", "url": "" }, { "id": "63519", "database": "ChEBI", "url": "" }, { "id": "63519", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2065239", "participant_name": "Chondroitin chain [lysosomal lumen]", "crossref": [ { "id": "63511", "database": "ChEBI", "url": "" }, { "id": "63511", "database": "ChEBI", "url": "" }, { "id": "63511", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "D3ZJF9", "gene_name": "Gla", "activity": [ { "ec_number": "3.2.1.-", "activity": "", "evidence": [ { "id": "D3ZJF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZJF9" } ] } ] }, { "uniprot_ac": "D3ZLZ7", "gene_name": "Impdh1", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "D3ZLZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLZ7" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "D3ZLZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLZ7" } ] } ] }, { "uniprot_ac": "D3ZUM4", "gene_name": "Glb1", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "D3ZUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZUM4" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "D3ZUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZUM4" } ] } ] }, { "uniprot_ac": "D3ZZC1", "gene_name": "Txndc5", "activity": [ { "ec_number": "5.3.4.1", "activity": "Catalyzes the rearrangement of -S-S- bonds in proteins.", "evidence": [ { "id": "D3ZZC1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZZC1" } ] }, { "ec_number": "5.3.4.1", "activity": "", "evidence": [ { "id": "D3ZZC1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZZC1" } ] } ] }, { "uniprot_ac": "D4AC20", "gene_name": "Cda", "activity": [ { "ec_number": "3.5.4.5", "activity": "2'-deoxycytidine + H(+) + H2O = 2'-deoxyuridine + NH4(+).", "evidence": [ { "id": "D4AC20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC20" } ] }, { "ec_number": "3.5.4.5", "activity": "", "evidence": [ { "id": "D4AC20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC20" } ] } ] }, { "uniprot_ac": "D4AC85", "gene_name": "Qpct", "activity": [ { "ec_number": "2.3.2.5", "activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).", "evidence": [ { "id": "D4AC85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC85" } ] }, { "ec_number": "2.3.2.5", "activity": "", "evidence": [ { "id": "D4AC85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC85" } ] } ] }, { "uniprot_ac": "D4ADE8", "gene_name": "Ddx3x", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "D4ADE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADE8" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "D4ADE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADE8" } ] } ] }, { "uniprot_ac": "D4AE56", "gene_name": "Ptges2", "activity": [ { "ec_number": "5.3.99.3", "activity": "prostaglandin H2 = prostaglandin E2.", "evidence": [ { "id": "D4AE56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AE56" } ] }, { "ec_number": "5.3.99.3", "activity": "", "evidence": [ { "id": "D4AE56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AE56" } ] } ] }, { "uniprot_ac": "D4AEH9", "gene_name": "Agl", "activity": [ { "ec_number": "2.4.1.25", "activity": "Transfers a segment of a (1->4)-alpha-D-glucan to a new position in an acceptor, which may be glucose or a (1->4)-alpha-D-glucan.", "evidence": [ { "id": "D4AEH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AEH9" } ] }, { "ec_number": "3.2.1.33", "activity": "Hydrolysis of (1->6)-alpha-D-glucosidic branch linkages in glycogen phosphorylase limit dextrin.", "evidence": [ { "id": "D4AEH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AEH9" } ] }, { "ec_number": "3.2.1.33", "activity": "", "evidence": [ { "id": "D4AEH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AEH9" } ] }, { "ec_number": "2.4.1.25", "activity": "", "evidence": [ { "id": "D4AEH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AEH9" } ] } ] }, { "uniprot_ac": "E9PU28", "gene_name": "Impdh2", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "E9PU28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PU28" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "E9PU28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PU28" } ] } ] }, { "uniprot_ac": "F1M1H0", "gene_name": "Dera", "activity": [ { "ec_number": "4.1.2.4", "activity": "2-deoxy-D-ribose 5-phosphate = acetaldehyde + D-glyceraldehyde 3-phosphate.", "evidence": [ { "id": "F1M1H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M1H0" } ] }, { "ec_number": "4.1.2.4", "activity": "", "evidence": [ { "id": "F1M1H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M1H0" } ] } ] }, { "uniprot_ac": "F7FLB2", "gene_name": "Pgm2", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "F7FLB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7FLB2" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "F7FLB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7FLB2" } ] } ] }, { "uniprot_ac": "M0RD14", "gene_name": "LOC100362738", "activity": [ { "ec_number": "2.7.1.40", "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.", "evidence": [ { "id": "M0RD14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RD14" } ] }, { "ec_number": "2.7.1.40", "activity": "", "evidence": [ { "id": "M0RD14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RD14" } ] } ] }, { "uniprot_ac": "O08730", "gene_name": "Gyg1", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "O08730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08730" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "O08730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08730" } ] } ] }, { "uniprot_ac": "O09178", "gene_name": "Ampd3", "activity": [ { "ec_number": "3.5.4.6", "activity": "AMP + H(+) + H2O = IMP + NH4(+).", "evidence": [ { "id": "O09178", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09178" } ] }, { "ec_number": "3.5.4.6", "activity": "", "evidence": [ { "id": "O09178", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09178" } ] } ] }, { "uniprot_ac": "O35244", "gene_name": "Prdx6", "activity": [ { "ec_number": "1.11.1.27", "activity": "a hydroperoxide + 2 glutathione = an alcohol + glutathione disulfide + H2O.", "evidence": [ { "id": "O35244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35244" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "O35244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35244" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "O35244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35244" } ] }, { "ec_number": "1.11.1.27", "activity": "", "evidence": [ { "id": "O35244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35244" } ] } ] }, { "uniprot_ac": "O35264", "gene_name": "Pafah1b2", "activity": [ { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "O35264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35264" } ] }, { "ec_number": "3.1.1.47", "activity": "", "evidence": [ { "id": "O35264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35264" } ] } ] }, { "uniprot_ac": "P00697", "gene_name": "Lyz1", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "P00697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00697" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "P00697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00697" } ] } ] }, { "uniprot_ac": "P00762", "gene_name": "Prss1", "activity": [ { "ec_number": "3.4.21.4", "activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.", "evidence": [ { "id": "P00762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00762" } ] }, { "ec_number": "3.4.21.4", "activity": "", "evidence": [ { "id": "P00762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00762" } ] } ] }, { "uniprot_ac": "P00763", "gene_name": "Prss2", "activity": [ { "ec_number": "3.4.21.4", "activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.", "evidence": [ { "id": "P00763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00763" } ] }, { "ec_number": "3.4.21.4", "activity": "", "evidence": [ { "id": "P00763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00763" } ] } ] }, { "uniprot_ac": "P00787", "gene_name": "Ctsb", "activity": [ { "ec_number": "3.4.22.1", "activity": "Hydrolysis of proteins with broad specificity for peptide bonds. Preferentially cleaves -Arg-Arg-|-Xaa bonds in small molecule substrates (thus differing from cathepsin L). In addition to being an endopeptidase, shows peptidyl-dipeptidase activity, liberating C-terminal dipeptides.", "evidence": [ { "id": "P00787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00787" } ] }, { "ec_number": "3.4.22.1", "activity": "", "evidence": [ { "id": "P00787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00787" } ] } ] }, { "uniprot_ac": "P04762", "gene_name": "Cat", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P04762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04762" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P04762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04762" } ] } ] }, { "uniprot_ac": "P04906", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] } ] }, { "uniprot_ac": "P05065", "gene_name": "Aldoa", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P05065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05065" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P05065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05065" } ] } ] }, { "uniprot_ac": "P05197", "gene_name": "Eef2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05197" } ] } ] }, { "uniprot_ac": "P06214", "gene_name": "Alad", "activity": [ { "ec_number": "4.2.1.24", "activity": "2 5-aminolevulinate = H(+) + 2 H2O + porphobilinogen.", "evidence": [ { "id": "P06214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06214" } ] }, { "ec_number": "4.2.1.24", "activity": "", "evidence": [ { "id": "P06214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06214" } ] } ] }, { "uniprot_ac": "P06760", "gene_name": "Gusb", "activity": [ { "ec_number": "3.2.1.31", "activity": "a beta-D-glucuronoside + H2O = an alcohol + D-glucuronate.", "evidence": [ { "id": "P06760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06760" } ] }, { "ec_number": "3.2.1.31", "activity": "", "evidence": [ { "id": "P06760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06760" } ] } ] }, { "uniprot_ac": "P07824", "gene_name": "Arg1", "activity": [ { "ec_number": "3.5.3.1", "activity": "H2O + L-arginine = L-ornithine + urea.", "evidence": [ { "id": "P07824", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07824" } ] }, { "ec_number": "3.5.3.1", "activity": "", "evidence": [ { "id": "P07824", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07824" } ] } ] }, { "uniprot_ac": "P09117", "gene_name": "Aldoc", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P09117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09117" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P09117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09117" } ] } ] }, { "uniprot_ac": "P09215", "gene_name": "Prkcd", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P09215", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09215" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P09215", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09215" } ] } ] }, { "uniprot_ac": "P09811", "gene_name": "Pygl", "activity": [ { "ec_number": "2.4.1.1", "activity": "[(1->4)-alpha-D-glucosyl](n) + phosphate = [(1->4)-alpha-D-glucosyl](n-1) + alpha-D-glucose 1-phosphate.", "evidence": [ { "id": "P09811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09811" } ] }, { "ec_number": "2.4.1.1", "activity": "", "evidence": [ { "id": "P09811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09811" } ] } ] }, { "uniprot_ac": "P10111", "gene_name": "Ppia", "activity": [ { "ec_number": "5.2.1.8", "activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).", "evidence": [ { "id": "P10111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10111" } ] }, { "ec_number": "5.2.1.8", "activity": "", "evidence": [ { "id": "P10111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10111" } ] } ] }, { "uniprot_ac": "P12527", "gene_name": "Alox5", "activity": [ { "ec_number": "1.13.11.-", "activity": "", "evidence": [ { "id": "P12527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12527" } ] }, { "ec_number": "1.13.11.34", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4.", "evidence": [ { "id": "P12527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12527" } ] } ] }, { "uniprot_ac": "P13676", "gene_name": "Apeh", "activity": [ { "ec_number": "3.4.19.1", "activity": "Internal cleavage of oxidized and glycated proteins.", "evidence": [ { "id": "P13676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13676" } ] }, { "ec_number": "3.4.19.1", "activity": "", "evidence": [ { "id": "P13676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13676" } ] } ] }, { "uniprot_ac": "P15589", "gene_name": "Sts", "activity": [ { "ec_number": "3.1.6.2", "activity": "dehydroepiandrosterone 3-sulfate + H2O = 3beta-hydroxyandrost-5-en-17-one + H(+) + sulfate.", "evidence": [ { "id": "P15589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15589" } ] }, { "ec_number": "3.1.6.2", "activity": "", "evidence": [ { "id": "P15589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15589" } ] } ] }, { "uniprot_ac": "P16638", "gene_name": "Acly", "activity": [ { "ec_number": "2.3.3.8", "activity": "acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA.", "evidence": [ { "id": "P16638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16638" } ] }, { "ec_number": "2.3.3.8", "activity": "", "evidence": [ { "id": "P16638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16638" } ] } ] }, { "uniprot_ac": "P17164", "gene_name": "Fuca1", "activity": [ { "ec_number": "3.2.1.51", "activity": "an alpha-L-fucoside + H2O = an alcohol + L-fucose.", "evidence": [ { "id": "P17164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17164" } ] }, { "ec_number": "3.2.1.51", "activity": "", "evidence": [ { "id": "P17164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17164" } ] } ] }, { "uniprot_ac": "P19132", "gene_name": "Fth1", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "P19132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19132" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "P19132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19132" } ] } ] }, { "uniprot_ac": "P19804", "gene_name": "Nme2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] } ] }, { "uniprot_ac": "P20070", "gene_name": "Cyb5r3", "activity": [ { "ec_number": "1.6.2.2", "activity": "2 Fe(III)-[cytochrome b5] + NADH = 2 Fe(II)-[cytochrome b5] + H(+) + NAD(+).", "evidence": [ { "id": "P20070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20070" } ] }, { "ec_number": "1.6.2.2", "activity": "", "evidence": [ { "id": "P20070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20070" } ] } ] }, { "uniprot_ac": "P20717", "gene_name": "Padi2", "activity": [ { "ec_number": "3.5.3.15", "activity": "H2O + L-arginyl-[protein] = L-citrullyl-[protein] + NH4(+).", "evidence": [ { "id": "P20717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20717" } ] }, { "ec_number": "3.5.3.15", "activity": "", "evidence": [ { "id": "P20717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20717" } ] } ] }, { "uniprot_ac": "P24268", "gene_name": "Ctsd", "activity": [ { "ec_number": "3.4.23.5", "activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.", "evidence": [ { "id": "P24268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24268" } ] }, { "ec_number": "3.4.23.5", "activity": "", "evidence": [ { "id": "P24268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24268" } ] } ] }, { "uniprot_ac": "P25113", "gene_name": "Pgam1", "activity": [ { "ec_number": "5.4.2.11", "activity": "(2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate.", "evidence": [ { "id": "P25113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25113" } ] }, { "ec_number": "5.4.2.4", "activity": "(2R)-3-phospho-glyceroyl phosphate = (2R)-2,3-bisphosphoglycerate + H(+).", "evidence": [ { "id": "P25113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25113" } ] }, { "ec_number": "5.4.2.4", "activity": "", "evidence": [ { "id": "P25113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25113" } ] }, { "ec_number": "5.4.2.11", "activity": "", "evidence": [ { "id": "P25113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25113" } ] } ] }, { "uniprot_ac": "P27926", "gene_name": "Hk3", "activity": [ { "ec_number": "2.7.1.1", "activity": "ATP + D-fructose = ADP + D-fructose 6-phosphate + H(+).", "evidence": [ { "id": "P27926", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27926" } ] }, { "ec_number": "2.7.1.1", "activity": "", "evidence": [ { "id": "P27926", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27926" } ] } ] }, { "uniprot_ac": "P30349", "gene_name": "Lta4h", "activity": [ { "ec_number": "3.3.2.6", "activity": "H2O + leukotriene A4 = leukotriene B4.", "evidence": [ { "id": "P30349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30349" } ] }, { "ec_number": "3.4.11.4", "activity": "Release of the N-terminal residue from a tripeptide.", "evidence": [ { "id": "P30349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30349" } ] }, { "ec_number": "3.3.2.6", "activity": "", "evidence": [ { "id": "P30349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30349" } ] } ] }, { "uniprot_ac": "P30835", "gene_name": "Pfkl", "activity": [ { "ec_number": "2.7.1.11", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H(+).", "evidence": [ { "id": "P30835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30835" } ] }, { "ec_number": "2.7.1.11", "activity": "", "evidence": [ { "id": "P30835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30835" } ] } ] }, { "uniprot_ac": "P30904", "gene_name": "Mif", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "P30904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30904" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "P30904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30904" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "P30904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30904" } ] } ] }, { "uniprot_ac": "P30919", "gene_name": "Aga", "activity": [ { "ec_number": "3.5.1.26", "activity": "H2O + N(4)-(beta-N-acetyl-D-glucosaminyl)-L-asparagine = H(+) + L-aspartate + N-acetyl-beta-D-glucosaminylamine.", "evidence": [ { "id": "P30919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30919" } ] }, { "ec_number": "3.5.1.26", "activity": "", "evidence": [ { "id": "P30919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30919" } ] } ] }, { "uniprot_ac": "P32038", "gene_name": "Cfd", "activity": [ { "ec_number": "3.4.21.46", "activity": "Selective cleavage of Arg-|-Lys bond in complement factor B when in complex with complement subcomponent C3b or with cobra venom factor.", "evidence": [ { "id": "P32038", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32038" } ] }, { "ec_number": "3.4.21.46", "activity": "", "evidence": [ { "id": "P32038", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32038" } ] } ] }, { "uniprot_ac": "P38652", "gene_name": "Pgm1", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "P38652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38652" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "P38652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38652" } ] } ] }, { "uniprot_ac": "P41562", "gene_name": "Idh1", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "P41562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41562" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "P41562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41562" } ] } ] }, { "uniprot_ac": "P46462", "gene_name": "Vcp", "activity": [ { "ec_number": "3.6.4.6", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P46462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46462" } ] }, { "ec_number": "3.6.4.6", "activity": "", "evidence": [ { "id": "P46462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46462" } ] } ] }, { "uniprot_ac": "P50282", "gene_name": "Mmp9", "activity": [ { "ec_number": "3.4.24.35", "activity": "Cleavage of gelatin types I and V and collagen types IV and V.", "evidence": [ { "id": "P50282", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50282" } ] }, { "ec_number": "3.4.24.35", "activity": "", "evidence": [ { "id": "P50282", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50282" } ] } ] }, { "uniprot_ac": "P50430", "gene_name": "Arsb", "activity": [ { "ec_number": "3.1.6.12", "activity": "Hydrolysis of the 4-sulfate groups of the N-acetyl-D-galactosamine 4-sulfate units of chondroitin sulfate and dermatan sulfate.", "evidence": [ { "id": "P50430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50430" } ] }, { "ec_number": "3.1.6.12", "activity": "", "evidence": [ { "id": "P50430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50430" } ] } ] }, { "uniprot_ac": "P53534", "gene_name": "Pygb", "activity": [ { "ec_number": "2.4.1.1", "activity": "[(1->4)-alpha-D-glucosyl](n) + phosphate = [(1->4)-alpha-D-glucosyl](n-1) + alpha-D-glucose 1-phosphate.", "evidence": [ { "id": "P53534", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53534" } ] }, { "ec_number": "2.4.1.1", "activity": "", "evidence": [ { "id": "P53534", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53534" } ] } ] }, { "uniprot_ac": "P62630", "gene_name": "Eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62630" } ] } ] }, { "uniprot_ac": "P63018", "gene_name": "Hspa8", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P63018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63018" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P63018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63018" } ] } ] }, { "uniprot_ac": "P63086", "gene_name": "Mapk1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P63086", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63086" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P63086", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63086" } ] } ] }, { "uniprot_ac": "P70618", "gene_name": "Mapk14", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70618" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P70618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70618" } ] } ] }, { "uniprot_ac": "P70709", "gene_name": "Rnase3", "activity": [ { "ec_number": "3.1.27.-", "activity": "", "evidence": [ { "id": "P70709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70709" } ] } ] }, { "uniprot_ac": "P80067", "gene_name": "Ctsc", "activity": [ { "ec_number": "3.4.14.1", "activity": "Release of an N-terminal dipeptide, Xaa-Yaa-|-Zaa-, except when Xaa is Arg or Lys, or Yaa or Zaa is Pro.", "evidence": [ { "id": "P80067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80067" } ] }, { "ec_number": "3.4.14.1", "activity": "", "evidence": [ { "id": "P80067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80067" } ] } ] }, { "uniprot_ac": "P82995", "gene_name": "Hsp90aa1", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P82995", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82995" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P82995", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82995" } ] } ] }, { "uniprot_ac": "P85973", "gene_name": "Pnp", "activity": [ { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "P85973", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P85973" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "P85973", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P85973" } ] } ] }, { "uniprot_ac": "P97571", "gene_name": "Capn1", "activity": [ { "ec_number": "3.4.22.52", "activity": "Broad endopeptidase specificity.", "evidence": [ { "id": "P97571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97571" } ] }, { "ec_number": "3.4.22.52", "activity": "", "evidence": [ { "id": "P97571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97571" } ] } ] }, { "uniprot_ac": "Q02765", "gene_name": "Ctss", "activity": [ { "ec_number": "3.4.22.27", "activity": "Similar to cathepsin L, but with much less activity on Z-Phe-Arg-|-NHMec, and more activity on the Z-Val-Val-Arg-|-Xaa compound.", "evidence": [ { "id": "Q02765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02765" } ] }, { "ec_number": "3.4.22.27", "activity": "", "evidence": [ { "id": "Q02765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02765" } ] } ] }, { "uniprot_ac": "Q32KJ2", "gene_name": "Arsk", "activity": [ { "ec_number": "3.1.6.1", "activity": "an aryl sulfate + H2O = a phenol + H(+) + sulfate.", "evidence": [ { "id": "Q32KJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ2" } ] }, { "ec_number": "3.1.6.18", "activity": "Hydrolysis of the 2-sulfate groups of the 2-O-sulfo-D-glucuronate residues of chondroitin sulfate, heparin and heparitin sulfate.", "evidence": [ { "id": "Q32KJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ2" } ] }, { "ec_number": "3.1.6.1", "activity": "", "evidence": [ { "id": "Q32KJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ2" } ] } ] }, { "uniprot_ac": "Q32KJ5", "gene_name": "Gns", "activity": [ { "ec_number": "3.1.6.14", "activity": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate.", "evidence": [ { "id": "Q32KJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ5" } ] }, { "ec_number": "3.1.6.14", "activity": "", "evidence": [ { "id": "Q32KJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ5" } ] } ] }, { "uniprot_ac": "Q32KJ6", "gene_name": "Galns", "activity": [ { "ec_number": "3.1.6.4", "activity": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-galactosamine 6-sulfate units of chondroitin sulfate and of the D-galactose 6-sulfate units of keratan sulfate.", "evidence": [ { "id": "Q32KJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ6" } ] }, { "ec_number": "3.1.6.4", "activity": "", "evidence": [ { "id": "Q32KJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ6" } ] } ] }, { "uniprot_ac": "Q32KJ8", "gene_name": "Arsi", "activity": [ { "ec_number": "3.1.6.-", "activity": "", "evidence": [ { "id": "Q32KJ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ8" } ] } ] }, { "uniprot_ac": "Q32KJ9", "gene_name": "Arsg", "activity": [ { "ec_number": "3.1.6.1", "activity": "an aryl sulfate + H2O = a phenol + H(+) + sulfate.", "evidence": [ { "id": "Q32KJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ9" } ] }, { "ec_number": "3.1.6.15", "activity": "Hydrolysis of the 3-sulfate groups of the N-sulfo-D-glucosamine 3-O-sulfate units of heparin.", "evidence": [ { "id": "Q32KJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ9" } ] }, { "ec_number": "3.1.6.1", "activity": "", "evidence": [ { "id": "Q32KJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ9" } ] } ] }, { "uniprot_ac": "Q32KK0", "gene_name": "Arsl", "activity": [ { "ec_number": "3.1.6.1", "activity": "an aryl sulfate + H2O = a phenol + H(+) + sulfate.", "evidence": [ { "id": "Q32KK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KK0" } ] } ] }, { "uniprot_ac": "Q3MIE4", "gene_name": "Vat1", "activity": [ { "ec_number": "1.-.-.-", "activity": "", "evidence": [ { "id": "Q3MIE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MIE4" } ] } ] }, { "uniprot_ac": "Q62662", "gene_name": "Frk", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q62662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62662" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q62662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62662" } ] } ] }, { "uniprot_ac": "Q62867", "gene_name": "Ggh", "activity": [ { "ec_number": "3.4.19.9", "activity": "(6S)-5,6,7,8-tetrahydrofolyl-(gamma-L-Glu)(n) + (n-1) H2O = (6S)-5,6,7,8-tetrahydrofolate + (n-1) L-glutamate.", "evidence": [ { "id": "Q62867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62867" } ] }, { "ec_number": "3.4.19.9", "activity": "", "evidence": [ { "id": "Q62867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62867" } ] } ] }, { "uniprot_ac": "Q66H71", "gene_name": "Cpped1", "activity": [ { "ec_number": "3.1.3.16", "activity": "H2O + O-phospho-L-threonyl-[protein] = L-threonyl-[protein] + phosphate.", "evidence": [ { "id": "Q66H71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H71" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q66H71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H71" } ] } ] }, { "uniprot_ac": "Q6AXR4", "gene_name": "Hexb", "activity": [ { "ec_number": "3.2.1.52", "activity": "Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.", "evidence": [ { "id": "Q6AXR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXR4" } ] }, { "ec_number": "3.2.1.52", "activity": "", "evidence": [ { "id": "Q6AXR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXR4" } ] } ] }, { "uniprot_ac": "Q6AYS4", "gene_name": "Fuca2", "activity": [ { "ec_number": "3.2.1.51", "activity": "an alpha-L-fucoside + H2O = an alcohol + L-fucose.", "evidence": [ { "id": "Q6AYS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYS4" } ] }, { "ec_number": "3.2.1.51", "activity": "", "evidence": [ { "id": "Q6AYS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYS4" } ] } ] }, { "uniprot_ac": "Q6P6V0", "gene_name": "Gpi", "activity": [ { "ec_number": "5.3.1.9", "activity": "alpha-D-glucose 6-phosphate = beta-D-fructose 6-phosphate.", "evidence": [ { "id": "Q6P6V0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P6V0" } ] }, { "ec_number": "5.3.1.9", "activity": "", "evidence": [ { "id": "Q6P6V0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P6V0" } ] } ] }, { "uniprot_ac": "Q6P7S1", "gene_name": "Asah1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q6P7S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q6P7S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q6P7S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ] } ] }, { "uniprot_ac": "Q6XQN1", "gene_name": "Naprt", "activity": [ { "ec_number": "6.3.4.21", "activity": "5-phospho-alpha-D-ribose 1-diphosphate + ATP + H2O + nicotinate = ADP + diphosphate + nicotinate beta-D-ribonucleotide + phosphate.", "evidence": [ { "id": "Q6XQN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XQN1" } ] }, { "ec_number": "6.3.4.21", "activity": "", "evidence": [ { "id": "Q6XQN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XQN1" } ] } ] }, { "uniprot_ac": "Q8K4Y7", "gene_name": "Cant1", "activity": [ { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q8K4Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4Y7" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q8K4Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4Y7" } ] } ] }, { "uniprot_ac": "Q9EPB1", "gene_name": "Dpp7", "activity": [ { "ec_number": "3.4.14.2", "activity": "Release of an N-terminal dipeptide, Xaa-Yaa-|-, preferentially when Yaa is Ala or Pro. Substrates are oligopeptides, preferentially tripeptides.", "evidence": [ { "id": "Q9EPB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EPB1" } ] }, { "ec_number": "3.4.14.2", "activity": "", "evidence": [ { "id": "Q9EPB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EPB1" } ] } ] }, { "uniprot_ac": "Q9JHW0", "gene_name": "Psmb7", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "Q9JHW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHW0" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "Q9JHW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHW0" } ] } ] }, { "uniprot_ac": "Q9R1T3", "gene_name": "Ctsz", "activity": [ { "ec_number": "3.4.18.1", "activity": "Release of C-terminal amino acid residues with broad specificity, but lacks action on C-terminal proline. Shows weak endopeptidase activity.", "evidence": [ { "id": "Q9R1T3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1T3" } ] }, { "ec_number": "3.4.18.1", "activity": "", "evidence": [ { "id": "Q9R1T3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1T3" } ] } ] }, { "uniprot_ac": "Q9Z0V5", "gene_name": "Prdx4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q9Z0V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0V5" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q9Z0V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0V5" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }