{ "uniprot_canonical_ac": "P49715-1", "uniprot_ac": "P49715", "uniprot_id": "CEBPA_HUMAN", "mass": { "chemical_mass": 37561.0, "monoisotopic_mass": 37561.0 }, "refseq": { "ac": "NP_001272758", "name": "CCAAT/enhancer-binding protein alpha isoform b", "summary": "This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. Mutation of this gene is associated with acute myeloid leukemia. The use of alternative in-frame non-AUG (GUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the GUG and the first AUG start codons. [provided by RefSeq, Dec 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758" }, "gene_names": [ { "name": "CEBPA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P49715", "id": "P49715" }, { "name": "C/EBP-alpha; CEBP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758", "id": "NP_001272758" }, { "name": "CEBPA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758", "id": "NP_001272758" }, { "name": "CEBP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P49715", "id": "P49715" } ], "protein_names": [ { "name": "CCAAT/enhancer-binding protein alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P49715" }, { "name": "C/EBP alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P49715" }, { "name": "CCAAT/enhancer binding protein (C/EBP), alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758", "id": "NP_001272758" }, { "name": "CCAAT/enhancer-binding protein alpha isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758", "id": "NP_001272758" } ], "function": [ { "annotation": "C/ebpalpha represses the oncogenic Runx3-Myc axis in p53-deficient osteosarcoma development.", "evidence": [ { "database": "RefSeq", "id": "NP_001272758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758" }, { "database": "PubMed", "id": "37402881", "url": "https://glygen.org/publication/PubMed/37402881" } ] }, { "annotation": "Can act as dominant-negative. Binds DNA and have transctivation activity, even if much less efficiently than isoform 2. Does not inhibit cell proliferation (PubMed:14660596).", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715#function" }, { "database": "UniProtKB", "id": "P05554", "url": "https://www.uniprot.org/uniprot/P05554#function" }, { "database": "UniProtKB", "id": "P53566", "url": "https://www.uniprot.org/uniprot/P53566#function" }, { "database": "PubMed", "id": "14660596", "url": "https://glygen.org/publication/PubMed/14660596" } ] }, { "annotation": "Demonstration of alternative translation initiation of the mouse ortholog", "evidence": [ { "database": "RefSeq", "id": "NP_001272758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758" }, { "database": "PubMed", "id": "8415748", "url": "https://glygen.org/publication/PubMed/8415748" } ] }, { "annotation": "Directly and specifically enhances ribosomal DNA transcription interacting with RNA polymerase I-specific cofactors and inducing histone acetylation.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715#function" }, { "database": "PubMed", "id": "20075868", "url": "https://glygen.org/publication/PubMed/20075868" } ] }, { "annotation": "Mutational studies of the rat and chick orthologs demonstrating alternative translational initiation", "evidence": [ { "database": "RefSeq", "id": "NP_001272758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758" }, { "database": "PubMed", "id": "10921906", "url": "https://glygen.org/publication/PubMed/10921906" } ] }, { "annotation": "Results suggest that control of rRNA synthesis is a novel function of C/EBPalpha adding to its role as key regulator of cell growth and proliferation.", "evidence": [ { "database": "RefSeq", "id": "NP_001272758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758" }, { "database": "PubMed", "id": "20075868", "url": "https://glygen.org/publication/PubMed/20075868" } ] }, { "annotation": "This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. Mutation of this gene is associated with acute myeloid leukemia. The use of alternative in-frame non-AUG (GUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the GUG and the first AUG start codons. [provided by RefSeq, Dec 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_001272758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758" } ] }, { "annotation": "Transcription factor that coordinates proliferation arrest and the differentiation of myeloid progenitors, adipocytes, hepatocytes, and cells of the lung and the placenta. Binds directly to the consensus DNA sequence 5'-T[TG]NNGNAA[TG]-3' acting as an activator on distinct target genes (PubMed:11242107). During early embryogenesis, plays essential and redundant functions with CEBPB. Essential for the transition from common myeloid progenitors (CMP) to granulocyte/monocyte progenitors (GMP). Critical for the proper development of the liver and the lung (By similarity). Necessary for terminal adipocyte differentiation, is required for postnatal maintenance of systemic energy homeostasis and lipid storage (By similarity). To regulate these different processes at the proper moment and tissue, interplays with other transcription factors and modulators. Down-regulates the expression of genes that maintain cells in an undifferentiated and proliferative state through E2F1 repression, which is critical for its ability to induce adipocyte and granulocyte terminal differentiation. Reciprocally E2F1 blocks adipocyte differentiation by binding to specific promoters and repressing CEBPA binding to its target gene promoters. Proliferation arrest also depends on a functional binding to SWI/SNF complex (PubMed:14660596). In liver, regulates gluconeogenesis and lipogenesis through different mechanisms. To regulate gluconeogenesis, functionally cooperates with FOXO1 binding to IRE-controlled promoters and regulating the expression of target genes such as PCK1 or G6PC1. To modulate lipogenesis, interacts and transcriptionally synergizes with SREBF1 in promoter activation of specific lipogenic target genes such as ACAS2. In adipose tissue, seems to act as FOXO1 coactivator accessing to ADIPOQ promoter through FOXO1 binding sites (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715#function" }, { "database": "UniProtKB", "id": "P05554", "url": "https://www.uniprot.org/uniprot/P05554#function" }, { "database": "UniProtKB", "id": "P53566", "url": "https://www.uniprot.org/uniprot/P53566#function" }, { "database": "PubMed", "id": "11242107", "url": "https://glygen.org/publication/PubMed/11242107" }, { "database": "PubMed", "id": "14660596", "url": "https://glygen.org/publication/PubMed/14660596" } ] } ], "disease": [ { "disease_id": "DOID:9119", "recommended_name": { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myeloid leukemia", "description": "A myeloid leukemia that is characterized by the rapid growth of abnormal white blood cells that accumulate in the bone marrow and interfere with the production of normal blood cells." }, "synonyms": [ { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "AML - acute Myeloid Leukemia", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "Leukemia, Myelocytic, acute", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myeloblastic leukaemia", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myeloblastic leukemia", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myelogenous leukaemia", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myelogenous leukemia", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myeloid leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloid leukemia", "description": "Acute myeloid leukemia (AML) is a group of neoplasms arising from precursor cells committed to the myeloid cell-line differentiation. All of them are characterized by clonal expansion of myeloid blasts. AML manifests by fever, pallor, anemia, hemorrhages and recurrent infections." }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "AML", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "AML - acute myeloid leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "AML - acute myeloid leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "ANLL", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute Nonlymphocytic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute Nonlymphocytic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute granulocytic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute granulocytic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloblastic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloblastic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myelocytic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myelocytic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myelogenous leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myelogenous leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myelogenous leukemias", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloid leukaemia (AML)", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloid leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloid leukemia (AML)", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloid leukemia, somatic", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute nonlymphocytic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute nonlymphocytic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "hematopoeitic - acute Myleogenous leukaemia (AML)", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "hematopoeitic - acute Myleogenous leukemia (AML)", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid, reduced survival in, somatic", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid, somatic", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, myelocytic, acute", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "myeloid leukemia, acute", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "myeloid leukemia, acute, M4/M4Eo subtype, somatic", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute non lymphoblastic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute non lymphoblastic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myelogenous", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid, susceptibility to", "description": "" }, { "id": "MIM:601626", "resource": "MIM", "url": "https://www.omim.org/entry/601626", "name": "Leukemia, acute myelogenous", "description": "Leukemia, acute myelogenous" } ], "evidence": [ { "id": "601626", "database": "MIM", "url": "https://www.omim.org/entry/601626" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 55, "end_pos": 55, "sequence_org": "I", "sequence_mut": "A", "comment": "Decreased interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 57, "end_pos": 57, "sequence_org": "E", "sequence_mut": "T", "comment": "No effect on interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 58, "end_pos": 58, "sequence_org": "H", "sequence_mut": "D", "comment": "No effect on interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 59, "end_pos": 59, "sequence_org": "E", "sequence_mut": "A", "comment": "Decreased interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 61, "end_pos": 61, "sequence_org": "S", "sequence_mut": "A", "comment": "Decreased interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 62, "end_pos": 62, "sequence_org": "I", "sequence_mut": "A", "comment": "Decreased interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 64, "end_pos": 64, "sequence_org": "I", "sequence_mut": "A", "comment": "Decreased interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 65, "end_pos": 65, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 67, "end_pos": 67, "sequence_org": "Y", "sequence_mut": "A", "comment": "Decreased interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 67, "end_pos": 67, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 68, "end_pos": 68, "sequence_org": "I", "sequence_mut": "A", "comment": "Decreased interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "start_pos": 69, "end_pos": 69, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "71.08", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "82.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "79.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "75.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "81.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "82.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "84.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "80.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "76.59", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "73.7", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "90.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "79.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "86.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P49715", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49715" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "common_name": "Human" } ], "gene": [ { "name": "CEBPA", "url": "https://www.uniprot.org/uniprot/P49715", "locus": { "chromosome": "19", "start_pos": 33299934, "end_pos": 33302534, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000245848", "url": "https://www.ensembl.org/id/ENSG00000245848" } ] } } ], "crossref": [ { "id": "ENSG00000245848", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000245848", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd14711", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14711", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CEBPA", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CEBPA", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "1050", "url": "https://www.ncbi.nlm.nih.gov/gene/1050", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1833", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1833", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P49715", "url": "https://www.ebi.ac.uk/intact/interactors/id:P49715*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004827", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004827", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016468", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016468", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1050", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1050", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "116897", "url": "http://www.omim.org/entry/116897", "database": "MIM", "categories": [ "Other" ] }, { "id": "601626", "url": "http://www.omim.org/entry/601626", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P49715", "url": "https://www.nextprot.org/entry/NX_P49715", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "QMPHLQY", "url": "https://omabrowser.org/oma/group/QMPHLQY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2959124at2759", "url": "http://www.orthodb.org/?query=2959124at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23334", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23334", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23334:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23334:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "6DC0", "url": "https://www.rcsb.org/structure/6DC0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF07716", "url": "http://pfam.xfam.org/family/PF07716", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P49715", "url": "https://pharos.nih.gov/targets/P49715", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P49715", "url": "http://purl.obolibrary.org/obo/PR_P49715", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001272758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P49715-1", "url": "https://www.uniprot.org/uniprot/P49715-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P49715-2", "url": "https://www.uniprot.org/uniprot/P49715-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P49715-3", "url": "https://www.uniprot.org/uniprot/P49715-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P49715-4", "url": "https://www.uniprot.org/uniprot/P49715-4", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA", "length": 358, "header": "sp|P49715-1|CEBPA_HUMAN Isoform 1 of CCAAT/enhancer-binding protein alpha OS=Homo sapiens OX=9606 GN=CEBPA PE=1 SV=3 CANONICAL=P49715-1" }, "isoforms": [ { "isoform_ac": "P49715-1", "url": "", "sequence": { "sequence": "MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA", "length": 358, "header": "sp|P49715-1|CEBPA_HUMAN Isoform 1 of CCAAT/enhancer-binding protein alpha OS=Homo sapiens OX=9606 GN=CEBPA PE=1 SV=3 CANONICAL=P49715-1" }, "locus": { "chromosome": "19", "start_pos": 33302414, "end_pos": 33301341, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000498907.3", "url": "https://www.ensembl.org/id/ENST00000498907.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000427514.1", "url": "https://www.ensembl.org/id/ENSP00000427514.1" } ] } }, { "isoform_ac": "P49715-2", "url": "", "sequence": { "sequence": "MSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA", "length": 344, "header": "sp|P49715-2|CEBPA_HUMAN Isoform 2 of CCAAT/enhancer-binding protein alpha OS=Homo sapiens OX=9606 GN=CEBPA PE=1 SV=3 CANONICAL=P49715-1" }, "locus": {} }, { "isoform_ac": "P49715-3", "url": "", "sequence": { "sequence": "MPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA", "length": 239, "header": "sp|P49715-3|CEBPA_HUMAN Isoform 3 of CCAAT/enhancer-binding protein alpha OS=Homo sapiens OX=9606 GN=CEBPA PE=1 SV=3 CANONICAL=P49715-1" }, "locus": {} }, { "isoform_ac": "P49715-4", "url": "", "sequence": { "sequence": "MRGRGRAGSPGGRRRRPAQAGGRRGSPCRENSNSPMESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA", "length": 393, "header": "sp|P49715-4|CEBPA_HUMAN Isoform 4 of CCAAT/enhancer-binding protein alpha OS=Homo sapiens OX=9606 GN=CEBPA PE=1 SV=3 CANONICAL=P49715-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 190, "end_pos": 190, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "15107404", "url": "https://glygen.org/publication/PubMed/15107404" }, { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "site_lbl": "Ser190" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "20516642", "url": "https://glygen.org/publication/PubMed/20516642" }, { "database": "PubMed", "id": "22797303", "url": "https://glygen.org/publication/PubMed/22797303" } ], "site_lbl": "Ser21" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P49715", "url": "http://phospho.elm.eu.org/byAccession/P49715.html" }, { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "14701740", "url": "https://glygen.org/publication/PubMed/14701740" } ], "site_lbl": "Ser21" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "14701740", "url": "https://glygen.org/publication/PubMed/14701740" }, { "database": "phospho.ELM", "id": "P49715", "url": "http://phospho.elm.eu.org/byAccession/P49715.html" } ], "site_lbl": "Ser21" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "14701740", "url": "https://glygen.org/publication/PubMed/14701740" }, { "database": "PubMed", "id": "16446383", "url": "https://glygen.org/publication/PubMed/16446383" }, { "database": "PubMed", "id": "16807249", "url": "https://glygen.org/publication/PubMed/16807249" }, { "database": "PubMed", "id": "19544470", "url": "https://glygen.org/publication/PubMed/19544470" }, { "database": "PubMed", "id": "20101026", "url": "https://glygen.org/publication/PubMed/20101026" }, { "database": "PubMed", "id": "21912254", "url": "https://glygen.org/publication/PubMed/21912254" }, { "database": "PubMed", "id": "22212957", "url": "https://glygen.org/publication/PubMed/22212957" }, { "database": "PubMed", "id": "22349414", "url": "https://glygen.org/publication/PubMed/22349414" }, { "database": "PubMed", "id": "22474248", "url": "https://glygen.org/publication/PubMed/22474248" }, { "database": "PubMed", "id": "22797303", "url": "https://glygen.org/publication/PubMed/22797303" }, { "database": "PubMed", "id": "23814099", "url": "https://glygen.org/publication/PubMed/23814099" }, { "database": "PubMed", "id": "25753223", "url": "https://glygen.org/publication/PubMed/25753223" } ], "site_lbl": "Ser21" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "10567568", "url": "https://glygen.org/publication/PubMed/10567568" } ], "site_lbl": "Thr226" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by GSK3", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "site_lbl": "Thr226" }, { "start_pos": 230, "end_pos": 230, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "10567568", "url": "https://glygen.org/publication/PubMed/10567568" } ], "site_lbl": "Thr230" }, { "start_pos": 230, "end_pos": 230, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by GSK3", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "site_lbl": "Thr230" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "20516642", "url": "https://glygen.org/publication/PubMed/20516642" }, { "database": "PubMed", "id": "22797303", "url": "https://glygen.org/publication/PubMed/22797303" } ], "site_lbl": "Ser234" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by GSK3", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "10567568", "url": "https://glygen.org/publication/PubMed/10567568" } ], "site_lbl": "Ser234" }, { "start_pos": 277, "end_pos": 277, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "1527059", "url": "https://glygen.org/publication/PubMed/1527059" } ], "site_lbl": "Ser277" }, { "start_pos": 299, "end_pos": 299, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "1527059", "url": "https://glygen.org/publication/PubMed/1527059" } ], "site_lbl": "Ser299" } ], "glycation": [], "keywords": [], "publication": [ { "title": "p300 interacts with the N- and C-terminal part of PPARgamma2 in a ligand-independent and -dependent manner, respectively.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gelman L, Zhou G, Fajas L, Raspe E, Fruchart JC, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "10075656", "url": "https://glygen.org/publication/PubMed/10075656" } ] }, { "title": "C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters.", "journal": "Blood", "date": "1999", "authors": "Verbeek W, Gombart AF, Chumakov AM, Muller C, Friedman AD, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "10233885", "url": "https://glygen.org/publication/PubMed/10233885" } ] }, { "title": "CCAAT/enhancer binding protein epsilon is a potential retinoid target gene in acute promyelocytic leukemia treatment.", "journal": "The Journal of clinical investigation", "date": "1999", "authors": "Park DJ, Chumakov AM, Vuong PT, Chih DY, Gombart AF, Miller WH Jr, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "10330422", "url": "https://glygen.org/publication/PubMed/10330422" } ] }, { "title": "PPARgamma activation induces the expression of the adipocyte fatty acid binding protein gene in human monocytes.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Pelton PD, Zhou L, Demarest KT, Burris TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "10425206", "url": "https://glygen.org/publication/PubMed/10425206" } ] }, { "title": "Glycogen synthase kinase 3 is an insulin-regulated C/EBPalpha kinase.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Ross SE, Erickson RL, Hemati N, MacDougald OA", "evidence": [ { "database": "iPTMnet", "id": "P49715-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715-1" } ], "reference": [ { "type": "PubMed", "id": "10567568", "url": "https://glygen.org/publication/PubMed/10567568" } ] }, { "title": "Ubinuclein, a novel nuclear protein interacting with cellular and viral transcription factors.", "journal": "J. Cell Biol.", "date": "2000", "authors": "Aho S, Buisson M, Pajunen T, Ryoo YW, Giot JF, Gruffat H, Sergeant A, Uitto J", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "10725330", "url": "https://glygen.org/publication/PubMed/10725330" } ] }, { "title": "Translational control of C/EBPalpha and C/EBPbeta isoform expression.", "journal": "Genes & development", "date": "2000", "authors": "Calkhoven CF, Muller C, Leutz A", "evidence": [ { "database": "RefSeq", "id": "NP_001272758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758" } ], "reference": [ { "type": "PubMed", "id": "10921906", "url": "https://glygen.org/publication/PubMed/10921906" } ] }, { "title": "Activation of human peroxisome proliferator-activated receptor (PPAR) subtypes by pioglitazone.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Sakamoto J, Kimura H, Moriyama S, Odaka H, Momose Y, Sugiyama Y, Sawada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "11095972", "url": "https://glygen.org/publication/PubMed/11095972" } ] }, { "title": "Dominant-negative mutations of CEBPA, encoding CCAAT/enhancer binding protein-alpha (C/EBPalpha), in acute myeloid leukemia.", "journal": "Nat. Genet.", "date": "2001", "authors": "Pabst T, Mueller BU, Zhang P, Radomska HS, Narravula S, Schnittger S, Behre G, Hiddemann W, Tenen DG", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11242107", "url": "https://glygen.org/publication/PubMed/11242107" } ] }, { "title": "c-Myc is a critical target for c/EBPalpha in granulopoiesis.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Johansen LM, Iwama A, Lodie TA, Sasaki K, Felsher DW, Golub TR, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11340171", "url": "https://glygen.org/publication/PubMed/11340171" } ] }, { "title": "CCAAT/enhancer-binding protein-alpha cooperates with p21 to inhibit cyclin-dependent kinase-2 activity and induces growth arrest independent of DNA binding.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Harris TE, Albrecht JH, Nakanishi M, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11369759", "url": "https://glygen.org/publication/PubMed/11369759" } ] }, { "title": "Use of chromatin immunoprecipitation to clone novel E2F target promoters.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Weinmann AS, Bartley SM, Zhang T, Zhang MQ, Farnham PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11564866", "url": "https://glygen.org/publication/PubMed/11564866" } ] }, { "title": "C/EBPalpha arrests cell proliferation through direct inhibition of Cdk2 and Cdk4.", "journal": "Molecular cell", "date": "2001", "authors": "Wang H, Iakova P, Wilde M, Welm A, Goode T, Roesler WJ, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11684017", "url": "https://glygen.org/publication/PubMed/11684017" } ] }, { "title": "C/EBPalpha triggers proteasome-dependent degradation of cdk4 during growth arrest.", "journal": "The EMBO journal", "date": "2002", "authors": "Wang H, Goode T, Iakova P, Albrecht JH, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11867521", "url": "https://glygen.org/publication/PubMed/11867521" } ] }, { "title": "Regional differences in the response of human pre-adipocytes to PPARgamma and RXRalpha agonists.", "journal": "Diabetes", "date": "2002", "authors": "Sewter CP, Blows F, Vidal-Puig A, O'Rahilly S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "11872672", "url": "https://glygen.org/publication/PubMed/11872672" } ] }, { "title": "Leptin gene expression in human preadipocytes is switched on by maturation-induced demethylation of distinct CpGs in its proximal promoter.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Melzner I, Scott V, Dorsch K, Fischer P, Wabitsch M, Bruderlein S, Hasel C, Moller P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "12213831", "url": "https://glygen.org/publication/PubMed/12213831" } ] }, { "title": "Calreticulin interacts with C/EBPalpha and C/EBPbeta mRNAs and represses translation of C/EBP proteins.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Timchenko LT, Iakova P, Welm AL, Cai ZJ, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12242300", "url": "https://glygen.org/publication/PubMed/12242300" } ] }, { "title": "Mutations of CEBPA in acute myeloid leukemia FAB types M1 and M2.", "journal": "Genes Chromosomes Cancer", "date": "2003", "authors": "Smith M.L., Fitzgibbon J., Amess J.A., Arch R., Cambal-Parrales M., Dixon-McIver A., Lister T.A., Neat M., Rohatiner A.Z., Snaddon J.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "12661007", "url": "https://glygen.org/publication/PubMed/12661007" } ] }, { "title": "Transcription activation function of C/EBPalpha is required for induction of granulocytic differentiation.", "journal": "Blood", "date": "2003", "authors": "Keeshan K, Santilli G, Corradini F, Perrotti D, Calabretta B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12702500", "url": "https://glygen.org/publication/PubMed/12702500" } ] }, { "title": "Induction of adiponectin, a fat-derived antidiabetic and antiatherogenic factor, by nuclear receptors.", "journal": "Diabetes", "date": "2003", "authors": "Iwaki M, Matsuda M, Maeda N, Funahashi T, Matsuzawa Y, Makishima M, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "12829629", "url": "https://glygen.org/publication/PubMed/12829629" } ] }, { "title": "The amino terminal and E2F interaction domains are critical for C/EBP alpha-mediated induction of granulopoietic development of hematopoietic cells.", "journal": "Blood", "date": "2003", "authors": "D'Alo' F, Johansen LM, Nelson EA, Radomska HS, Evans EK, Zhang P, Nerlov C, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12869508", "url": "https://glygen.org/publication/PubMed/12869508" } ] }, { "title": "Restoration of C/EBPalpha expression in a BCR-ABL+ cell line induces terminal granulocytic differentiation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tavor S, Park DJ, Gery S, Vuong PT, Gombart AF, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "14517214", "url": "https://glygen.org/publication/PubMed/14517214" } ] }, { "title": "The CCAAT enhancer-binding protein alpha (C/EBPalpha) requires a SWI/SNF complex for proliferation arrest.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Leutz A., Calkhoven C.F., Muller C., Sha X.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "14660596", "url": "https://glygen.org/publication/PubMed/14660596" } ] }, { "title": "Phosphorylation of C/EBPalpha inhibits granulopoiesis.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Ross SE, Radomska HS, Wu B, Zhang P, Winnay JN, Bajnok L, Wright WS, Schaufele F, Tenen DG, MacDougald OA", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "14701740", "url": "https://glygen.org/publication/PubMed/14701740" } ] }, { "title": "CCAAT/enhancer binding protein alpha binds to the Epstein-Barr virus (EBV) ZTA protein through oligomeric interactions and contributes to cooperative transcriptional activation of the ZTA promoter through direct binding to the ZII and ZIIIB motifs during induction of the EBV lytic cycle.", "journal": "J. Virol.", "date": "2004", "authors": "Wang L., Chen H., Hayward S.D., Wu F.Y., Hayward G.S., Wang S.E.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "15078966", "url": "https://glygen.org/publication/PubMed/15078966" } ] }, { "title": "Liver tumors escape negative control of proliferation via PI3K/Akt-mediated block of C/EBP alpha growth inhibitory activity.", "journal": "Genes & development", "date": "2004", "authors": "Wang GL, Iakova P, Wilde M, Awad S, Timchenko NA", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "15107404", "url": "https://glygen.org/publication/PubMed/15107404" } ] }, { "title": "Phosphorylation of CCAAT-enhancer binding protein by protein kinase C attenuates site-selective DNA binding.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Mahoney CW, Shuman J, McKnight SL, Chen HC, Huang KP", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "1527059", "url": "https://glygen.org/publication/PubMed/1527059" } ] }, { "title": "Human adipocyte fatty acid-binding protein (aP2) gene promoter-driven reporter assay discriminates nonlipogenic peroxisome proliferator-activated receptor gamma ligands.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2004", "authors": "Rival Y, Stennevin A, Puech L, Rouquette A, Cathala C, Lestienne F, Dupont-Passelaigue E, Patoiseau JF, Wurch T, Junquero D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15273253", "url": "https://glygen.org/publication/PubMed/15273253" } ] }, { "title": "Mutation of CEBPA in familial acute myeloid leukemia.", "journal": "N. Engl. J. Med.", "date": "2004", "authors": "Smith M.L., Fitzgibbon J., Cavenagh J.D., Lister T.A.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "15575056", "url": "https://glygen.org/publication/PubMed/15575056" } ] }, { "title": "Identification of the promoter region required for human adiponectin gene transcription: Association with CCAAT/enhancer binding protein-beta and tumor necrosis factor-alpha.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Kita A, Yamasaki H, Kuwahara H, Moriuchi A, Fukushima K, Kobayashi M, Fukushima T, Takahashi R, Abiru N, Uotani S, Kawasaki E, Eguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15850785", "url": "https://glygen.org/publication/PubMed/15850785" } ] }, { "title": "C/EBPalpha regulates human adiponectin gene transcription through an intronic enhancer.", "journal": "Diabetes", "date": "2005", "authors": "Qiao L, Maclean PS, Schaack J, Orlicky DJ, Darimont C, Pagliassotti M, Friedman JE, Shao J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15919796", "url": "https://glygen.org/publication/PubMed/15919796" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "Block of C/EBP alpha function by phosphorylation in acute myeloid leukemia with FLT3 activating mutations.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Radomska HS, Basseres DS, Zheng R, Zhang P, Dayaram T, Yamamoto Y, Sternberg DW, Lokker N, Giese NA, Bohlander SK, Schnittger S, Delmotte MH, Davis RJ, Small D, Hiddemann W, Gilliland DG, Tenen DG", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "16446383", "url": "https://glygen.org/publication/PubMed/16446383" } ] }, { "title": "C/EBPbeta is required for 'emergency' granulopoiesis.", "journal": "Nature immunology", "date": "2006", "authors": "Hirai H, Zhang P, Dayaram T, Hetherington CJ, Mizuno S, Imanishi J, Akashi K, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "16751774", "url": "https://glygen.org/publication/PubMed/16751774" } ] }, { "title": "CCAAT/enhancer-binding protein alpha mediates induction of hepatic phosphoenolpyruvate carboxykinase by p38 mitogen-activated protein kinase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Qiao L, MacDougald OA, Shao J", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "16807249", "url": "https://glygen.org/publication/PubMed/16807249" } ] }, { "title": "Transcriptional control of adipocyte formation.", "journal": "Cell metabolism", "date": "2006", "authors": "Farmer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "17011499", "url": "https://glygen.org/publication/PubMed/17011499" } ] }, { "title": "LEF-1 is crucial for neutrophil granulocytopoiesis and its expression is severely reduced in congenital neutropenia.", "journal": "Nature medicine", "date": "2006", "authors": "Skokowa J, Cario G, Uenalan M, Schambach A, Germeshausen M, Battmer K, Zeidler C, Lehmann U, Eder M, Baum C, Grosschedl R, Stanulla M, Scherr M, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "17063141", "url": "https://glygen.org/publication/PubMed/17063141" } ] }, { "title": "PML-retinoic acid receptor alpha inhibits PML IV enhancement of PU.1-induced C/EBPepsilon expression in myeloid differentiation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Yoshida H, Ichikawa H, Tagata Y, Katsumoto T, Ohnishi K, Akao Y, Naoe T, Pandolfi PP, Kitabayashi I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "17562868", "url": "https://glygen.org/publication/PubMed/17562868" } ] }, { "title": "Effect of heterodimer partner RXRalpha on PPARgamma activation function-2 helix in solution.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Lu J, Chen M, Stanley SE, Li E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "17980149", "url": "https://glygen.org/publication/PubMed/17980149" } ] }, { "title": "C/EBPalpha and C/EBPvarepsilon induce the monocytic differentiation of myelomonocytic cells with the MLL-chimeric fusion gene.", "journal": "Oncogene", "date": "2008", "authors": "Matsushita H, Nakajima H, Nakamura Y, Tsukamoto H, Tanaka Y, Jin G, Yabe M, Asai S, Ono R, Nosaka T, Sugita K, Morimoto A, Hayashi Y, Hotta T, Ando K, Miyachi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "18776924", "url": "https://glygen.org/publication/PubMed/18776924" } ] }, { "title": "Identification of a novel distal enhancer in human adiponectin gene.", "journal": "The Journal of endocrinology", "date": "2009", "authors": "Segawa K, Matsuda M, Fukuhara A, Morita K, Okuno Y, Komuro R, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "18931025", "url": "https://glygen.org/publication/PubMed/18931025" } ] }, { "title": "Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.", "journal": "Nature", "date": "2008", "authors": "Chandra V, Huang P, Hamuro Y, Raghuram S, Wang Y, Burris TP, Rastinejad F", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19043829", "url": "https://glygen.org/publication/PubMed/19043829" } ] }, { "title": "A-FABP, a candidate progression marker of human transitional cell carcinoma of the bladder, is differentially regulated by PPAR in urothelial cancer cells.", "journal": "International journal of cancer", "date": "2009", "authors": "Boiteux G, Lascombe I, Roche E, Plissonnier ML, Clairotte A, Bittard H, Fauconnet S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19115207", "url": "https://glygen.org/publication/PubMed/19115207" } ] }, { "title": "Structural basis for the activation of PPARgamma by oxidized fatty acids.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Itoh T, Fairall L, Amin K, Inaba Y, Szanto A, Balint BL, Nagy L, Yamamoto K, Schwabe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19172745", "url": "https://glygen.org/publication/PubMed/19172745" } ] }, { "title": "p38 MAP kinase inhibits neutrophil development through phosphorylation of C/EBPalpha on serine 21.", "journal": "Stem cells (Dayton, Ohio)", "date": "2009", "authors": "Geest CR, Buitenhuis M, Laarhoven AG, Bierings MB, Bruin MC, Vellenga E, Coffer PJ", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "19544470", "url": "https://glygen.org/publication/PubMed/19544470" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Nucleolar retention of a translational C/EBPalpha isoform stimulates rDNA transcription and cell size.", "journal": "EMBO J.", "date": "2010", "authors": "Muller C, Bremer A, Schreiber S, Eichwald S, Calkhoven CF", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "RefSeq", "id": "NP_001272758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758" } ], "reference": [ { "type": "PubMed", "id": "20075868", "url": "https://glygen.org/publication/PubMed/20075868" } ] }, { "title": "Phosphorylation status of transcription factor C/EBPalpha determines cell-surface poly-LacNAc branching (I antigen) formation in erythropoiesis and granulopoiesis.", "journal": "Blood", "date": "2010", "authors": "Twu YC, Hsieh CY, Lin M, Tzeng CH, Sun CF, Yu LC", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "20101026", "url": "https://glygen.org/publication/PubMed/20101026" } ] }, { "title": "Human fetal mesenchymal stem cells differentiate into brown and white adipocytes: a role for ERRalpha in human UCP1 expression.", "journal": "Cell research", "date": "2010", "authors": "Morganstein DL, Wu P, Mane MR, Fisk NM, White R, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "20101261", "url": "https://glygen.org/publication/PubMed/20101261" } ] }, { "title": "Repression of transcriptional activity of C/EBPalpha by E2F-dimerization partner complexes.", "journal": "Mol. Cell. Biol.", "date": "2010", "authors": "Zaragoza K, Begay V, Schuetz A, Heinemann U, Leutz A", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "20176812", "url": "https://glygen.org/publication/PubMed/20176812" } ] }, { "title": "Differential ability of Tribbles family members to promote degradation of C/EBPalpha and induce acute myelogenous leukemia.", "journal": "Blood", "date": "2010", "authors": "Dedhia PH, Keeshan K, Uljon S, Xu L, Vega ME, Shestova O, Zaks-Zilberman M, Romany C, Blacklow SC, Pear WS", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "20410507", "url": "https://glygen.org/publication/PubMed/20410507" } ] }, { "title": "Elimination of C/EBPalpha through the ubiquitin-proteasome system promotes the development of liver cancer in mice.", "journal": "The Journal of clinical investigation", "date": "2010", "authors": "Wang GL, Shi X, Haefliger S, Jin J, Major A, Iakova P, Finegold M, Timchenko NA", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "20516642", "url": "https://glygen.org/publication/PubMed/20516642" } ] }, { "title": "C/EBPepsilon participates in all-trans retinoic acid induction of PI3Kgamma in U937 cells via an intronic matrix attachment region sequence.", "journal": "Molecular biology reports", "date": "2010", "authors": "Cai R, Cai X, Chen B, Xu W, Lu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "20661648", "url": "https://glygen.org/publication/PubMed/20661648" } ] }, { "title": "Protein disulfide isomerase blocks CEBPA translation and is up-regulated during the unfolded protein response in AML.", "journal": "Blood", "date": "2011", "authors": "Haefliger S, Klebig C, Schaubitzer K, Schardt J, Timchenko N, Mueller BU, Pabst T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "21471526", "url": "https://glygen.org/publication/PubMed/21471526" } ] }, { "title": "Molecular genetics of the blood group I system and the regulation of I antigen expression during erythropoiesis and granulopoiesis.", "journal": "Current opinion in hematology", "date": "2011", "authors": "Yu LC, Lin M", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "21912254", "url": "https://glygen.org/publication/PubMed/21912254" } ] }, { "title": "The granulocyte-associated transcription factor Kruppel-like factor 5 is silenced by hypermethylation in acute myeloid leukemia.", "journal": "Leukemia research", "date": "2012", "authors": "Diakiw SM, Kok CH, To LB, Lewis ID, Brown AL, D'Andrea RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "21993314", "url": "https://glygen.org/publication/PubMed/21993314" } ] }, { "title": "Phosphorylation of serine 21 modulates the proliferation inhibitory more than the differentiation inducing effects of C/EBPalpha in K562 cells.", "journal": "Journal of cellular biochemistry", "date": "2012", "authors": "Fragliasso V, Chiodo Y, Ferrari-Amorotti G, Soliera AR, Manzotti G, Cattelani S, Candini O, Grisendi G, Vergalli J, Mariani SA, Guerzoni C, Calabretta B", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "22212957", "url": "https://glygen.org/publication/PubMed/22212957" } ] }, { "title": "Post-transcriptional modulation of C/EBPalpha prompts monocytic differentiation and apoptosis in acute myelomonocytic leukaemia cells.", "journal": "Leukemia research", "date": "2012", "authors": "Yoshida H, Imamura T, Fujiki A, Hirashima Y, Miyachi M, Inukai T, Hosoi H", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "22349414", "url": "https://glygen.org/publication/PubMed/22349414" } ] }, { "title": "Overexpression of wild-type or mutants forms of CEBPA alter normal human hematopoiesis.", "journal": "Leukemia", "date": "2012", "authors": "Quintana-Bustamante O, Lan-Lan Smith S, Griessinger E, Reyal Y, Vargaftig J, Lister TA, Fitzgibbon J, Bonnet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "22371011", "url": "https://glygen.org/publication/PubMed/22371011" } ] }, { "title": "C/EBPalpha and DEK coordinately regulate myeloid differentiation.", "journal": "Blood", "date": "2012", "authors": "Koleva RI, Ficarro SB, Radomska HS, Carrasco-Alfonso MJ, Alberta JA, Webber JT, Luckey CJ, Marcucci G, Tenen DG, Marto JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" }, { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "22474248", "url": "https://glygen.org/publication/PubMed/22474248" } ] }, { "title": "Targeting CDK1 promotes FLT3-activated acute myeloid leukemia differentiation through C/EBPalpha.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Radomska HS, Alberich-Jorda M, Will B, Gonzalez D, Delwel R, Tenen DG", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "22797303", "url": "https://glygen.org/publication/PubMed/22797303" } ] }, { "title": "Interactions among HCLS1, HAX1 and LEF-1 proteins are essential for G-CSF-triggered granulopoiesis.", "journal": "Nature medicine", "date": "2012", "authors": "Skokowa J, Klimiankou M, Klimenkova O, Lan D, Gupta K, Hussein K, Carrizosa E, Kusnetsova I, Li Z, Sustmann C, Ganser A, Zeidler C, Kreipe HH, Burkhardt J, Grosschedl R, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "23001182", "url": "https://glygen.org/publication/PubMed/23001182" } ] }, { "title": "A Novel pro-adipogenesis factor abundant in adipose tissues and over-expressed in obesity acts upstream of PPARgamma and C/EBPalpha.", "journal": "Journal of bioenergetics and biomembranes", "date": "2013", "authors": "Ni Y, Ji C, Wang B, Qiu J, Wang J, Guo X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "23239344", "url": "https://glygen.org/publication/PubMed/23239344" } ] }, { "title": "Interleukin (IL)-32beta-mediated CCAAT/enhancer-binding protein alpha (C/EBPalpha) phosphorylation by protein kinase Cdelta (PKCdelta) abrogates the inhibitory effect of C/EBPalpha on IL-10 production.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Kang JW, Park YS, Kim MS, Lee DH, Bak Y, Ham SY, Park SH, Hong JT, Yoon DY", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "23814099", "url": "https://glygen.org/publication/PubMed/23814099" } ] }, { "title": "Enhancement of differentiation induction and upregulation of CCAAT/enhancer-binding proteins and PU.1 in NB4 cells treated with combination of ATRA and valproic acid.", "journal": "International journal of oncology", "date": "2014", "authors": "Iriyama N, Yuan B, Yoshino Y, Hatta Y, Horikoshi A, Aizawa S, Takei M, Takeuchi J, Takagi N, Toyoda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "24379003", "url": "https://glygen.org/publication/PubMed/24379003" } ] }, { "title": "CEBPA-dependent HK3 and KLF5 expression in primary AML and during AML differentiation.", "journal": "Scientific reports", "date": "2014", "authors": "Federzoni EA, Humbert M, Torbett BE, Behre G, Fey MF, Tschan MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "24584857", "url": "https://glygen.org/publication/PubMed/24584857" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nat. Struct. Mol. Biol.", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "E1A-dependent trans-activation of the human MYC promoter is mediated by the E2F factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Hiebert SW, Lipp M, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "2524830", "url": "https://glygen.org/publication/PubMed/2524830" } ] }, { "title": "C/EBPalpha in normal and malignant myelopoiesis.", "journal": "International journal of hematology", "date": "2015", "authors": "Friedman AD", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" } ], "reference": [ { "type": "PubMed", "id": "25753223", "url": "https://glygen.org/publication/PubMed/25753223" } ] }, { "title": "miR-191 promotes tumorigenesis of human colorectal cancer through targeting C/EBPbeta.", "journal": "Oncotarget", "date": "2015", "authors": "Zhang XF, Li KK, Gao L, Li SZ, Chen K, Zhang JB, Wang D, Tu RF, Zhang JX, Tao KX, Wang G, Zhang XD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "25784653", "url": "https://glygen.org/publication/PubMed/25784653" } ] }, { "title": "Molecular mechanism of CCAAT-enhancer binding protein recruitment by the TRIB1 pseudokinase.", "journal": "Structure", "date": "2015", "authors": "Murphy JM, Nakatani Y, Jamieson SA, Dai W, Lucet IS, Mace PD", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "26455797", "url": "https://glygen.org/publication/PubMed/26455797" } ] }, { "title": "Structural basis for substrate selectivity of the E3 ligase COP1.", "journal": "Structure", "date": "2016", "authors": "Uljon S, Xu X, Durzynska I, Stein S, Adelmant G, Marto JA, Pear WS, Blacklow SC", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "27041596", "url": "https://glygen.org/publication/PubMed/27041596" } ] }, { "title": "Nuclear factor E2F mediates basic transcription and trans-activation by E1a of the human MYC promoter.", "journal": "Genes & development", "date": "1989", "authors": "Thalmeier K, Synovzik H, Mertz R, Winnacker EL, Lipp M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "2721961", "url": "https://glygen.org/publication/PubMed/2721961" } ] }, { "title": "The significance of c.690G>T polymorphism (rs34529039) and expression of the CEBPA gene in ovarian cancer outcome.", "journal": "Oncotarget", "date": "2016", "authors": "Konopka B, Szafron LM, Kwiatkowska E, Podgorska A, Zolocinska A, Pienkowska-Grela B, Dansonka-Mieszkowska A, Balcerak A, Lukasik M, Stachurska A, Timorek A, Spiewankiewicz B, El-Bahrawy M, Kupryjanczyk J", "evidence": [ { "database": "Entrez", "id": "1050", "url": "https://www.ncbi.nlm.nih.gov/gene/1050" } ], "reference": [ { "type": "PubMed", "id": "27602952", "url": "https://glygen.org/publication/PubMed/27602952" } ] }, { "title": "Comparative Transcriptomic and Epigenomic Analyses Reveal New Regulators of Murine Brown Adipogenesis.", "journal": "PLoS Genet.", "date": "2016", "authors": "Brunmeir R, Wu J, Peng X, Kim SY, Julien SG, Zhang Q, Xie W, Xu F", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "27923061", "url": "https://glygen.org/publication/PubMed/27923061" } ] }, { "title": "C/EBPalpha overrides epigenetic reprogramming by oncogenic transcription factors in acute myeloid leukemia.", "journal": "Blood advances", "date": "2018", "authors": "Loke J, Chin PS, Keane P, Pickin A, Assi SA, Ptasinska A, Imperato MR, Cockerill PN, Bonifer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "29431622", "url": "https://glygen.org/publication/PubMed/29431622" } ] }, { "title": "C/ebp\u03b1 represses the oncogenic Runx3-Myc axis in p53-deficient osteosarcoma development.", "journal": "Oncogene", "date": "2023-08", "authors": "Omori Keisuke, Otani Shohei, Date Yuki, Ueno Tomoya, Ito Tomoko, Umeda Masahiro, Ito Kosei", "evidence": [ { "database": "RefSeq", "id": "NP_001272758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758" } ], "reference": [ { "type": "PubMed", "id": "37402881", "url": "https://glygen.org/publication/PubMed/37402881" } ] }, { "title": "Molecular cloning, sequence, and expression patterns of the human gene encoding CCAAT/enhancer binding protein alpha (C/EBP alpha).", "journal": "Biochem. Biophys. Res. Commun.", "date": "1995", "authors": "Antonson P., Xanthopoulos K.G.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "7575576", "url": "https://glygen.org/publication/PubMed/7575576" } ] }, { "title": "Autoregulation of the human C/EBP alpha gene by stimulation of upstream stimulatory factor binding.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Timchenko N, Wilson DR, Taylor LR, Abdelsayed S, Wilde M, Sawadogo M, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "7862113", "url": "https://glygen.org/publication/PubMed/7862113" } ] }, { "title": "Insulin-responsive human adipocytes express two glucose transporter isoforms and target them to different vesicles.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1993", "authors": "Pilch PF, Wilkinson W, Garvey WT, Ciaraldi TP, Hueckstaedt TP, Olefsky JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8325954", "url": "https://glygen.org/publication/PubMed/8325954" } ] }, { "title": "A 30-kDa alternative translation product of the CCAAT/enhancer binding protein alpha message: transcriptional activator lacking antimitotic activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Lin FT, MacDougald OA, Diehl AM, Lane MD", "evidence": [ { "database": "RefSeq", "id": "NP_001272758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272758" } ], "reference": [ { "type": "PubMed", "id": "8415748", "url": "https://glygen.org/publication/PubMed/8415748" } ] }, { "title": "The adipocyte specific transcription factor C/EBPalpha modulates human ob gene expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Miller SG, De Vos P, Guerre-Millo M, Wong K, Hermann T, Staels B, Briggs MR, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8643605", "url": "https://glygen.org/publication/PubMed/8643605" } ] }, { "title": "PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells.", "journal": "Blood", "date": "1996", "authors": "Smith LT, Hohaus S, Gonzalez DA, Dziennis SE, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "8695841", "url": "https://glygen.org/publication/PubMed/8695841" } ] }, { "title": "A human peroxisome-proliferator-activated receptor-gamma is activated by inducers of adipogenesis, including thiazolidinedione drugs.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Lambe KG, Tugwood JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8706692", "url": "https://glygen.org/publication/PubMed/8706692" } ] }, { "title": "Thiazolidinediones repress ob gene expression in rodents via activation of peroxisome proliferator-activated receptor gamma.", "journal": "The Journal of clinical investigation", "date": "1996", "authors": "De Vos P, Lefebvre AM, Miller SG, Guerre-Millo M, Wong K, Saladin R, Hamann LG, Staels B, Briggs MR, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8770873", "url": "https://glygen.org/publication/PubMed/8770873" } ] }, { "title": "CCAAT/enhancer-binding protein alpha (C/EBP alpha) inhibits cell proliferation through the p21 (WAF-1/CIP-1/SDI-1) protein.", "journal": "Genes & development", "date": "1996", "authors": "Timchenko NA, Wilde M, Nakanishi M, Smith JR, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "8846917", "url": "https://glygen.org/publication/PubMed/8846917" } ] }, { "title": "Peroxisome proliferator-activated receptors: a nuclear receptor signaling pathway in lipid physiology.", "journal": "Annual review of cell and developmental biology", "date": "1996", "authors": "Lemberger T, Desvergne B, Wahli W", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8970730", "url": "https://glygen.org/publication/PubMed/8970730" } ] }, { "title": "Identification, characterization, and tissue distribution of human peroxisome proliferator-activated receptor (PPAR) isoforms PPARgamma2 versus PPARgamma1 and activation with retinoid X receptor agonists and antagonists.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mukherjee R, Jow L, Croston GE, Paterniti JR Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9065481", "url": "https://glygen.org/publication/PubMed/9065481" } ] }, { "title": "CCAAT/enhancer binding protein epsilon is preferentially up-regulated during granulocytic differentiation and its functional versatility is determined by alternative use of promoters and differential splicing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Yamanaka R, Kim GD, Radomska HS, Lekstrom-Himes J, Smith LT, Antonson P, Tenen DG, Xanthopoulos KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "9177240", "url": "https://glygen.org/publication/PubMed/9177240" } ] }, { "title": "Identification of high-affinity binding sites for the insulin sensitizer rosiglitazone (BRL-49653) in rodent and human adipocytes using a radioiodinated ligand for peroxisomal proliferator-activated receptor gamma.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1998", "authors": "Young PW, Buckle DR, Cantello BC, Chapman H, Clapham JC, Coyle PJ, Haigh D, Hindley RM, Holder JC, Kallender H, Latter AJ, Lawrie KW, Mossakowska D, Murphy GJ, Roxbee Cox L, Smith SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9454824", "url": "https://glygen.org/publication/PubMed/9454824" } ] }, { "title": "N-(2-Benzoylphenyl)-L-tyrosine PPARgamma agonists. 1. Discovery of a novel series of potent antihyperglycemic and antihyperlipidemic agents.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Henke BR, Blanchard SG, Brackeen MF, Brown KK, Cobb JE, Collins JL, Harrington WW Jr, Hashim MA, Hull-Ryde EA, Kaldor I, Kliewer SA, Lake DH, Leesnitzer LM, Lehmann JM, Lenhard JM, Orband-Miller LA, Miller JF, Mook RA Jr, Noble SA, Oliver W Jr, Parks DJ, Plunket KD, Szewczyk JR, Willson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9836620", "url": "https://glygen.org/publication/PubMed/9836620" } ] }, { "title": "Interaction of hepatitis B viral X protein and CCAAT/enhancer-binding protein alpha synergistically activates the hepatitis B viral enhancer II/pregenomic promoter.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Choi B.H., Park G.T., Rho H.M.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "reference": [ { "type": "PubMed", "id": "9915821", "url": "https://glygen.org/publication/PubMed/9915821" } ] } ], "pathway": [ { "id": "hsa:1050", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1050", "resource": "KEGG Pathway" }, { "id": "R-HSA-381340", "name": "Transcriptional regulation of white adipocyte differentiation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "resource": "Reactome", "description": "Transcriptional regulation of white adipocyte differentiation" }, { "id": "R-HSA-9616222", "name": "Transcriptional regulation of granulopoiesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222", "resource": "Reactome", "description": "Transcriptional regulation of granulopoiesis" } ], "orthologs": [ { "uniprot_canonical_ac": "P05554-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "Cebpa", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAAGLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA", "length": 358 }, "evidence": [ { "id": "45224994", "url": "http://www.informatics.jax.org/homology/45224994", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P53566-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "Cebpa", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MESADFYEVEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHAAPALGAAGLPGPGSALKGLAGAHPDLRTGGGGGGSGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA", "length": 359 }, "evidence": [ { "id": "45224994", "url": "http://www.informatics.jax.org/homology/45224994", "database": "MGI" }, { "id": "P49715", "url": "https://omabrowser.org/oma/group/P49715/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 41, "go_terms": [ { "name": "transcription by RNA polymerase I", "id": "GO:0006360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006360", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "granulocyte differentiation", "id": "GO:0030851", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030851", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "positive regulation of macrophage activation", "id": "GO:0043032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043032", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "liver development", "id": "GO:0001889", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001889", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "generation of precursor metabolites and energy", "id": "GO:0006091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006091", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "Notch signaling pathway", "id": "GO:0007219", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007219", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "cholesterol metabolic process", "id": "GO:0008203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008203", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "positive regulation of fat cell differentiation", "id": "GO:0045600", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045600", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "white fat cell differentiation", "id": "GO:0050872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050872", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "brown fat cell differentiation", "id": "GO:0050873", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050873", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "lipid homeostasis", "id": "GO:0055088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055088", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "lung development", "id": "GO:0030324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030324", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "glucose homeostasis", "id": "GO:0042593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042593", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "positive regulation of inflammatory response", "id": "GO:0050729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050729", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "fat cell differentiation", "id": "GO:0045444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045444", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "negative regulation of cyclin-dependent protein serine/threonine kinase activity", "id": "GO:0045736", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045736", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "mitochondrion organization", "id": "GO:0007005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007005", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "positive regulation of osteoblast differentiation", "id": "GO:0045669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045669", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "positive regulation of proteasomal ubiquitin-dependent protein catabolic process", "id": "GO:0032436", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032436", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "inner ear development", "id": "GO:0048839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048839", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "cellular response to tumor necrosis factor", "id": "GO:0071356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071356", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "cellular response to organic cyclic compound", "id": "GO:0071407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071407", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "urea cycle", "id": "GO:0000050", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000050", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "embryonic placenta development", "id": "GO:0001892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001892", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "hematopoietic stem cell proliferation", "id": "GO:0071425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071425", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "cytokine-mediated signaling pathway", "id": "GO:0019221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019221", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "epithelial cell maturation", "id": "GO:0002070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002070", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription initiation", "id": "GO:2000144", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000144", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "macrophage differentiation", "id": "GO:0030225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030225", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "cellular response to lithium ion", "id": "GO:0071285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071285", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "myeloid cell differentiation", "id": "GO:0030099", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030099", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "interleukin-6-mediated signaling pathway", "id": "GO:0070102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070102", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "integrated stress response signaling", "id": "GO:0140467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140467", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "negative regulation of hematopoietic stem cell proliferation", "id": "GO:1902034", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902034", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "CHOP-C/EBP complex", "id": "GO:0036488", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036488", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulator complex", "id": "GO:0090575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090575", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "C/EBP complex", "id": "GO:1990647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990647", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 13, "go_terms": [ { "name": "STAT family protein binding", "id": "GO:0097677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097677", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "kinase binding", "id": "GO:0019900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019900", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "chromatin DNA binding", "id": "GO:0031490", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031490", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" }, { "name": "RNA polymerase I transcription regulatory region sequence-specific DNA binding", "id": "GO:0001163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001163", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylation at Ser-190 is required for interaction with CDK2, CDK4 and SWI/SNF complex leading to cell cycle inhibition. Dephosphorylated at Ser-190 by protein phosphatase 2A (PP2A) through PI3K/AKT signaling pathway regulation (PubMed:15107404). Phosphorylation at Thr-226 and Thr-230 by GSK3 is constitutive in adipose tissue and lung. In liver, both Thr-226 and Thr-230 are phosphorylated only during feeding but not during fasting. Phosphorylation of the GSK3 consensus sites selectively decreases transactivation activity on IRE-controlled promoters.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "P53566", "url": "https://glygen.org/publication/PubMed/P53566" } ] }, { "annotation": "Sumoylated, sumoylation blocks the inhibitory effect on cell proliferation by disrupting the interaction with SMARCA2.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "P05554", "url": "https://glygen.org/publication/PubMed/P05554" } ] }, { "annotation": "Ubiquitinated by COP1 upon interaction with TRIB1.", "evidence": [ { "database": "UniProtKB", "id": "P49715", "url": "https://www.uniprot.org/uniprot/P49715" }, { "database": "PubMed", "id": "27041596", "url": "https://glygen.org/publication/PubMed/27041596" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 92 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }