{ "uniprot_canonical_ac": "P49573-1", "uniprot_ac": "P49573", "uniprot_id": "CTR1_YEAST", "mass": { "chemical_mass": 44442.0, "monoisotopic_mass": 44442.0 }, "refseq": { "ac": "NP_015449", "name": "high-affinity Cu transporter CTR1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015449" }, "gene_names": [ { "name": "CTR1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P49573", "id": "P49573" }, { "name": "CTR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015449", "id": "NP_015449" }, { "name": "P9642.3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P49573", "id": "P49573" } ], "protein_names": [ { "name": "Copper transport protein CTR1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P49573" }, { "name": "Copper transporter 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P49573" }, { "name": "high-affinity Cu transporter CTR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015449", "id": "NP_015449" } ], "function": [ { "annotation": "High-affinity copper transporter of plasma membrane that mediates copper uptake under low copper conditions (PubMed:8293472, PubMed:7929270, PubMed:8756349, PubMed:12391279). Copper transport through the high affinity system requiring CTRl supplies the iron transport multicopper ferroxidase FET3 with copper, which in turn is required for ferrous iron uptake (PubMed:8293472). The energy for translocation is unlikely to be directly derived from ATP hydrolysis and the exact mechanism driving the transmembrane transport of copper has still to be determined (PubMed:7929270). Binds 4 copper ions via its C-terminal cystein-rich domain and is able to deliver Cu(I) directly to both the chaperone ATX1 and to an N-terminal domain of the CCC2 protein (PubMed:15012137). Also able to mediate the uptake of the anticancer drug cisplatin (PubMed:12391279, PubMed:12370430, PubMed:14511662).", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573#function" }, { "database": "PubMed", "id": "7929270", "url": "https://glygen.org/publication/PubMed/7929270" }, { "database": "PubMed", "id": "8756349", "url": "https://glygen.org/publication/PubMed/8756349" }, { "database": "PubMed", "id": "12370430", "url": "https://glygen.org/publication/PubMed/12370430" }, { "database": "PubMed", "id": "14511662", "url": "https://glygen.org/publication/PubMed/14511662" }, { "database": "PubMed", "id": "15012137", "url": "https://glygen.org/publication/PubMed/15012137" }, { "database": "PubMed", "id": "12391279", "url": "https://glygen.org/publication/PubMed/12391279" }, { "database": "PubMed", "id": "8293472", "url": "https://glygen.org/publication/PubMed/8293472" } ] } ], "disease": [ { "disease_id": "DOID:1838", "recommended_name": { "id": "DOID:1838", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1838", "name": "Menkes disease", "description": "" }, "synonyms": [ { "id": "DOID:1838", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1838", "name": "COPPER TRANSPORT DISEASE", "description": "" }, { "id": "DOID:1838", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1838", "name": "Menkes kinky-hair syndrome", "description": "" }, { "id": "DOID:1838", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1838", "name": "steely hair syndrome", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "Menkes disease", "description": "A usually severe multisystemic disorder of copper metabolism, characterized by progressive neurodegeneration and marked connective tissue anomalies as well as typical sparse abnormal steely hair." }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "copper transport disease", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "MD", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "MNK", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "Menkes disease", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "Menkes kinky hair syndrome", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "Menkes kinky-hair syndrome", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "Menkes syndrome", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "Mk", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "Trichopoliodystrophy", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "X-linked copper deficiency", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "kinky hair disease", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "kinky hair syndrome", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "menkes disease, X-linked recessive", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "steely hair disease", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "steely hair syndrome", "description": "" }, { "id": "MONDO:0010651", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010651", "name": "Menkea syndrome", "description": "" }, { "id": "MIM:309400", "resource": "MIM", "url": "https://www.omim.org/entry/309400", "name": "Menkes disease", "description": "Menkes disease" } ], "evidence": [ { "id": "1838", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1838" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 304, "end_pos": 315, "sequence_org": "CPGFGNCQCGRH", "sequence_mut": "SPGFGNSQSGRS", "comment": "Causes defects in CTR1 turnover.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" }, { "database": "PubMed", "id": "12011036", "url": "https://glygen.org/publication/PubMed/12011036" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "common_name": "Yeast" } ], "gene": [ { "name": "CTR1", "url": "https://www.uniprot.org/uniprot/P49573", "locus": {} } ], "crossref": [ { "id": "856241", "url": "https://www.ncbi.nlm.nih.gov/gene/856241", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P49573", "url": "https://www.ebi.ac.uk/intact/interactors/id:P49573*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007274", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007274", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YPR124W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPR124W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LKRWDIQ", "url": "https://omabrowser.org/oma/group/LKRWDIQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1968119at2759", "url": "http://www.orthodb.org/?query=1968119at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12483", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12483", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12483:SF27", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12483:SF27", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04145", "url": "http://pfam.xfam.org/family/PF04145", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P49573", "url": "http://purl.obolibrary.org/obo/PR_P49573", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_015449", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015449", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000006328", "url": "https://www.yeastgenome.org/locus/S000006328", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P49573-1", "url": "https://www.uniprot.org/uniprot/P49573-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEGMNMGSSMNMDAMSSASKTVASSMASMSMDAMSSASKTILSSMSSMSMEAMSSASKTLASTMSSMASMSMGSSSMSGMSMSMSSTPTSSASAQTTSDSSMSGMSGMSSSDNSSSSGMDMDMSMGMNYYLTPTYKNYPVLFHHLHANNSGKAFGIFLLFVVAAFVYKLLLFVSWCLEVHWFKKWDKQNKYSTLPSANSKDEGKHYDTENNFEIQGLPKLPNLLSDIFVPSLMDLFHDIIRAFLVFTSTMIIYMLMLATMSFVLTYVFAVITGLALSEVFFNRCKIAMLKRWDIQREIQKAKSCPGFGNCQCGRHPEPSPDPIAVADTTSGSDQSTRLEKNNESKVAISENNQKKTPTQEEGCNCATDSGKNQANIERDILENSKLQEQSGNMDQNLLPAEKFTHN", "length": 406, "header": "sp|P49573-1|CTR1_YEAST Isoform 1 of Copper transport protein CTR1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=CTR1 PE=1 SV=1 CANONICAL=P49573-1" }, "isoforms": [ { "isoform_ac": "P49573-1", "url": "", "sequence": { "sequence": "MEGMNMGSSMNMDAMSSASKTVASSMASMSMDAMSSASKTILSSMSSMSMEAMSSASKTLASTMSSMASMSMGSSSMSGMSMSMSSTPTSSASAQTTSDSSMSGMSGMSSSDNSSSSGMDMDMSMGMNYYLTPTYKNYPVLFHHLHANNSGKAFGIFLLFVVAAFVYKLLLFVSWCLEVHWFKKWDKQNKYSTLPSANSKDEGKHYDTENNFEIQGLPKLPNLLSDIFVPSLMDLFHDIIRAFLVFTSTMIIYMLMLATMSFVLTYVFAVITGLALSEVFFNRCKIAMLKRWDIQREIQKAKSCPGFGNCQCGRHPEPSPDPIAVADTTSGSDQSTRLEKNNESKVAISENNQKKTPTQEEGCNCATDSGKNQANIERDILENSKLQEQSGNMDQNLLPAEKFTHN", "length": 406, "header": "sp|P49573-1|CTR1_YEAST Isoform 1 of Copper transport protein CTR1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=CTR1 PE=1 SV=1 CANONICAL=P49573-1" }, "locus": { "chromosome": "XVI", "start_pos": 787425, "end_pos": 786208, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YPR124W_mRNA", "url": "https://www.ensembl.org/id/YPR124W_mRNA" }, { "database": "Ensembl Peptide", "id": "YPR124W", "url": "https://www.ensembl.org/id/YPR124W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 303, "end_pos": 303, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P49573", "url": "https://www.yeastgenome.org/locus/P49573" }, { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser303" }, { "start_pos": 319, "end_pos": 319, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" }, { "database": "SGD", "id": "P49573", "url": "https://www.yeastgenome.org/locus/P49573" } ], "site_lbl": "Ser319" }, { "start_pos": 328, "end_pos": 328, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Thr328" }, { "start_pos": 329, "end_pos": 329, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Thr329" }, { "start_pos": 330, "end_pos": 330, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" }, { "database": "SGD", "id": "P49573", "url": "https://www.yeastgenome.org/locus/P49573" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser330" }, { "start_pos": 332, "end_pos": 332, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Ser332" }, { "start_pos": 335, "end_pos": 335, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" }, { "database": "SGD", "id": "P49573", "url": "https://www.yeastgenome.org/locus/P49573" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser335" }, { "start_pos": 336, "end_pos": 336, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Thr336" }, { "start_pos": 344, "end_pos": 344, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P49573", "url": "https://www.yeastgenome.org/locus/P49573" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser344" }, { "start_pos": 349, "end_pos": 349, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "SGD", "id": "P49573", "url": "https://www.yeastgenome.org/locus/P49573" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser349" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "SGD", "id": "P49573", "url": "https://www.yeastgenome.org/locus/P49573" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr356" }, { "start_pos": 358, "end_pos": 358, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "SGD", "id": "P49573", "url": "https://www.yeastgenome.org/locus/P49573" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr358" }, { "start_pos": 369, "end_pos": 369, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" }, { "database": "SGD", "id": "P49573", "url": "https://www.yeastgenome.org/locus/P49573" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser369" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The yeast transcription factor Mac1 binds to DNA in a modular fashion.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Winge D.R., Jensen L.T., Srinivasan C., Jamison McDaniels C.P., Tullius T.D.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "10480908", "url": "https://glygen.org/publication/PubMed/10480908" } ] }, { "title": "Identification of the copper regulon in Saccharomyces cerevisiae by DNA microarrays.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Brown P.O., Gross C., Winge D.R., Iyer V.R., Kelleher M.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "10922376", "url": "https://glygen.org/publication/PubMed/10922376" } ] }, { "title": "Antioxidant functions required for insusceptibility of Saccharomyces cerevisiae to tetracycline antibiotics.", "journal": "Antimicrob. Agents Chemother.", "date": "2001", "authors": "Avery S.V., Angrave F.E.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "11557497", "url": "https://glygen.org/publication/PubMed/11557497" } ] }, { "title": "Copper ion-sensing transcription factor Mac1p post-translationally controls the degradation of its target gene product Ctr1p.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Yonkovich Jesse, McKenndry Roslyn, Shi Xiaoli, Zhu Zhiwu", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "12011036", "url": "https://glygen.org/publication/PubMed/12011036" } ] }, { "title": "Uptake of the anticancer drug cisplatin mediated by the copper transporter Ctr1 in yeast and mammals.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2002", "authors": "Ishida S., Lee J., Thiele D.J., Herskowitz I.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "12370430", "url": "https://glygen.org/publication/PubMed/12370430" } ] }, { "title": "The copper transporter CTR1 regulates cisplatin uptake in Saccharomyces cerevisiae.", "journal": "Mol. Pharmacol.", "date": "2002", "authors": "Lin X., Howell S.B., Okuda T., Holzer A.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "12391279", "url": "https://glygen.org/publication/PubMed/12391279" } ] }, { "title": "Copper(II) protects yeast against the toxicity of cisplatin independently of the induction of metallothionein and the inhibition of platinum uptake.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2003", "authors": "Ohashi K., Hasegawa T., Inaba S., Seko Y., Kajiya K., Naganuma A., Furuchi T.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "14511662", "url": "https://glygen.org/publication/PubMed/14511662" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "C-terminal domain of the membrane copper transporter Ctr1 from Saccharomyces cerevisiae binds four Cu(I) ions as a cuprous-thiolate polynuclear cluster: sub-femtomolar Cu(I) affinity of three proteins involved in copper trafficking.", "journal": "J. Am. Chem. Soc.", "date": "2004", "authors": "Xiao Z., Howlett G.J., George G.N., Loughlin F., Wedd A.G.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "15012137", "url": "https://glygen.org/publication/PubMed/15012137" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "Journal of proteome research", "date": "2007-03", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" }, { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-06-19", "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" } ], "reference": [ { "type": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" }, { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "Sites of ubiquitin attachment in Saccharomyces cerevisiae.", "journal": "Proteomics", "date": "2012", "authors": "Eng J.K., Fields S., Lo R.S., Starita L.M., von Haller P.D.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "22106047", "url": "https://glygen.org/publication/PubMed/22106047" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P49573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49573" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The Saccharomyces cerevisiae copper transport protein (Ctr1p). Biochemical characterization, regulation by copper, and physiologic role in copper uptake.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Dancis A, Haile D, Yuan D S, Klausner R D", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "7929270", "url": "https://glygen.org/publication/PubMed/7929270" } ] }, { "title": "Molecular characterization of a copper transport protein in S. cerevisiae: an unexpected role for copper in iron transport.", "journal": "Cell", "date": "1994", "authors": "Kaplan J., Klausner R.D., Moehle C., Askwith C., Yuan D.S., Dancis A., Eide D., Haile D.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "8293472", "url": "https://glygen.org/publication/PubMed/8293472" } ] }, { "title": "Copper-dependent degradation of the Saccharomyces cerevisiae plasma membrane copper transporter Ctr1p in the apparent absence of endocytosis.", "journal": "EMBO J.", "date": "1996", "authors": "Bonifacino J.S., Klausner R.D., Ooi C.E., Rabinovich E., Dancis A.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "8670854", "url": "https://glygen.org/publication/PubMed/8670854" } ] }, { "title": "A widespread transposable element masks expression of a yeast copper transport gene.", "journal": "Genes Dev.", "date": "1996", "authors": "Thiele D.J., Kosman D.J., Knight S.A.B., Kwon L.F., Labbe S.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "8756349", "url": "https://glygen.org/publication/PubMed/8756349" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Davis K., Duesterhoeft A., Hillier L.W., Mewes H.-W., Pearson D., Schaefer M., Scharfe M., Wambutt R., Wang Y., Wedler H., Hall J., Bowman S., Chung E., Benes V., Botstein D., Brueckner M., Davis R.W., Lin A., Lin D., Duncan M., Barrell B.G., Rieger M., Ahmed A., Schroeder M., Oefner P., Delius H., Kleine K., Floeth M., Bussey H., Voss H., Lashkari D., Allen E., Dubois E., Hyman R.W., Aparicio A., Araujo R., Kalman S., Komp C., Kurdi O., Lew H., Namath A., Roberts D., Friesen J.D., Louis E.J., Johnston M., Pohl T.M., Schramm S., Cherry J.M., Badcock K., Churcher C.M., DiPaolo T., Dietrich F.S., Goffeau A., Hani J., Messenguy F., Mueller-Auer S., Rajandream M.A., Scherens B., Vissers S., Walsh S.V., Zollner A., Fortin N., Purnelle B., Sdicu A.-M., Storms R.K., Urrestarazu L.A., Vierendeels F., Vo D.H., Zhong W.-W., Albermann K., Carpenter J., Coster F., Fritz C., Hebling U., Heumann K., Hilbert H., Hunicke-Smith S., Marathe R., Mirtipati S., Moestl D., Nentwich U., Petel F.X., Rechmann S., Riles L., Tettelin H., Ushinsky S., Wedler E., Winnett E.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "9169875", "url": "https://glygen.org/publication/PubMed/9169875" } ] }, { "title": "Copper-specific transcriptional repression of yeast genes encoding critical components in the copper transport pathway.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Zhu Z., Thiele D.J., Labbe S.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "9188496", "url": "https://glygen.org/publication/PubMed/9188496" } ] }, { "title": "Homeostatic regulation of copper uptake in yeast via direct binding of MAC1 protein to upstream regulatory sequences of FRE1 and CTR1.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Yang W., Klausner R.D., Dancis A., Yamaguchi-Iwai Y., Serpe M., Kosman D.J., Haile D.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "9211922", "url": "https://glygen.org/publication/PubMed/9211922" } ] }, { "title": "Dynamic regulation of copper uptake and detoxification genes in Saccharomyces cerevisiae.", "journal": "Mol. Cell. Biol.", "date": "1998", "authors": "Koch K.A., Pena M.M., Thiele D.J.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "9599102", "url": "https://glygen.org/publication/PubMed/9599102" } ] }, { "title": "Mapping of the DNA binding domain of the copper-responsive transcription factor Mac1 from Saccharomyces cerevisiae.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Winge D.R., Jensen L.T., Srinivasan C., Posewitz M.C.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "9726991", "url": "https://glygen.org/publication/PubMed/9726991" } ] }, { "title": "Evidence for (Mac1p)2.DNA ternary complex formation in Mac1p-dependent transactivation at the CTR1 promoter.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Joshi A., Serpe M., Kosman D.J.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "reference": [ { "type": "PubMed", "id": "9867833", "url": "https://glygen.org/publication/PubMed/9867833" } ] } ], "pathway": [ { "id": "sce:YPR124W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPR124W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "copper ion transmembrane transporter activity", "id": "GO:0005375", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005375", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "copper ion import", "id": "GO:0015677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015677", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 113, "end_pos": 115, "annotation": "n_glycosylation_sequon" }, { "start_pos": 148, "end_pos": 150, "annotation": "n_glycosylation_sequon" }, { "start_pos": 342, "end_pos": 344, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Extensively O-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "P49573", "url": "https://www.uniprot.org/uniprot/P49573" }, { "database": "PubMed", "id": "7929270", "url": "https://glygen.org/publication/PubMed/7929270" } ] } ], "interactions": [], "reactions": [ { "id": "28703", "name": "", "equation": "Cu(2+)(in) = Cu(2+)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "28703", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/28703" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 13 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 29 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }