{
"uniprot_canonical_ac": "P49354-1",
"uniprot_ac": "P49354",
"uniprot_id": "FNTA_HUMAN",
"mass": {
"chemical_mass": 44409.0,
"monoisotopic_mass": 44409.0
},
"refseq": {
"ac": "NP_002018",
"name": "protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha",
"summary": "Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, May 2010].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018"
},
"gene_names": [
{
"name": "FNTA",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P49354",
"id": "P49354"
},
{
"name": "FNTA",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018",
"id": "NP_002018"
},
{
"name": "FPTA; PGGT1A; PTAR2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018",
"id": "NP_002018"
},
{
"name": "hCG_1993221",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P49354",
"id": "P49354"
}
],
"protein_names": [
{
"name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P49354"
},
{
"name": "2.5.1.58",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P49354"
},
{
"name": "2.5.1.59",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P49354"
},
{
"name": "CAAX farnesyltransferase subunit alpha",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P49354"
},
{
"name": "FTase-alpha",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P49354"
},
{
"name": "GGTase-I-alpha",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P49354"
},
{
"name": "Ras proteins prenyltransferase subunit alpha",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P49354"
},
{
"name": "Type I protein geranyl-geranyltransferase subunit alpha",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P49354"
},
{
"name": "protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018",
"id": "NP_002018"
},
{
"name": "protein prenyltransferase alpha subunit repeat containing 2; FTase-alpha; type I protein geranyl-geranyltransferase alpha subunit; GGTase-I-alpha; farnesyl-protein transferase alpha-subunit; ras proteins prenyltransferase subunit alpha",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018",
"id": "NP_002018"
}
],
"function": [
{
"annotation": "Cell-permeable CaaX-peptides affect K-Ras downstream signaling and promote cell death in cancer cells.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002018",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018"
},
{
"database": "PubMed",
"id": "33112492",
"url": "https://glygen.org/publication/PubMed/33112492"
}
]
},
{
"annotation": "Essential subunit of both the farnesyltransferase and the geranylgeranyltransferase complex. Contributes to the transfer of a farnesyl or geranylgeranyl moiety from farnesyl or geranylgeranyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. May positively regulate neuromuscular junction development downstream of MUSK via its function in RAC1 prenylation and activation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354#function"
},
{
"database": "PubMed",
"id": "12036349",
"url": "https://glygen.org/publication/PubMed/12036349"
},
{
"database": "PubMed",
"id": "8494894",
"url": "https://glygen.org/publication/PubMed/8494894"
},
{
"database": "PubMed",
"id": "12825937",
"url": "https://glygen.org/publication/PubMed/12825937"
},
{
"database": "PubMed",
"id": "16893176",
"url": "https://glygen.org/publication/PubMed/16893176"
},
{
"database": "PubMed",
"id": "19246009",
"url": "https://glygen.org/publication/PubMed/19246009"
},
{
"database": "PubMed",
"id": "8419339",
"url": "https://glygen.org/publication/PubMed/8419339"
}
]
},
{
"annotation": "Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, May 2010].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002018",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018"
}
]
},
{
"annotation": "Protein farnesylation is upregulated in Alzheimer's human brains and neuron-specific suppression of farnesyltransferase mitigates pathogenic processes in Alzheimer's model mice. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002018",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018"
},
{
"database": "PubMed",
"id": "34315531",
"url": "https://glygen.org/publication/PubMed/34315531"
}
]
},
{
"annotation": "Scaffold association factor B (SAFB) is required for expression of prenyltransferases and RAS membrane association. Erratum:[Proc Natl Acad Sci U S A. 2021 Jul 20;118(29):. PMID: 34261796]",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002018",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018"
},
{
"database": "PubMed",
"id": "33257571",
"url": "https://glygen.org/publication/PubMed/33257571"
}
]
}
],
"disease": [],
"snv": [],
"mutagenesis": [
{
"start_pos": 164,
"end_pos": 164,
"sequence_org": "K",
"sequence_mut": "N",
"comment": "Reduced activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "PubMed",
"id": "8419339",
"url": "https://glygen.org/publication/PubMed/8419339"
}
]
},
{
"start_pos": 199,
"end_pos": 199,
"sequence_org": "N",
"sequence_mut": "K",
"comment": "Reduced catalytic efficiency.",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "PubMed",
"id": "8494894",
"url": "https://glygen.org/publication/PubMed/8494894"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "95.1",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "98.44",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "94.11",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "97.83",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "96.61",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "95.25",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "90.48",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "97.11",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "95.72",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "94.29",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "94.53",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "96.05",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "96.63",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P49354",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P49354"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "FNTA",
"url": "https://www.uniprot.org/uniprot/P49354",
"locus": {
"chromosome": "8",
"start_pos": 43085788,
"end_pos": 43034194,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000168522",
"url": "https://www.ensembl.org/id/ENSG00000168522"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000168522",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000168522",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "2.5.1.58",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.5.1.58&UniProtAcc=P49354",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "2.5.1.59",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.5.1.59&UniProtAcc=P49354",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "CHEMBL271",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL271",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "FNTA",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FNTA",
"database": "GeneCards",
"categories": [
"Organism-specific",
"Gene Annotation"
]
},
{
"id": "2339",
"url": "https://www.ncbi.nlm.nih.gov/gene/2339",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "3782",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3782",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P49354",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P49354*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR002088",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR002088",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:2339",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2339",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "134635",
"url": "http://www.omim.org/entry/134635",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P49354",
"url": "https://www.nextprot.org/entry/NX_P49354",
"database": "neXtProt",
"categories": [
"Organism-specific",
"Protein"
]
},
{
"id": "DRLICED",
"url": "https://omabrowser.org/oma/group/DRLICED/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "20949at2759",
"url": "http://www.orthodb.org/?query=20949at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11129",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11129",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11129:SF1",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11129:SF1",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1JCQ",
"url": "https://www.rcsb.org/structure/1JCQ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1LD7",
"url": "https://www.rcsb.org/structure/1LD7",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1LD8",
"url": "https://www.rcsb.org/structure/1LD8",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1MZC",
"url": "https://www.rcsb.org/structure/1MZC",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1S63",
"url": "https://www.rcsb.org/structure/1S63",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1SA4",
"url": "https://www.rcsb.org/structure/1SA4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1TN6",
"url": "https://www.rcsb.org/structure/1TN6",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2F0Y",
"url": "https://www.rcsb.org/structure/2F0Y",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2H6F",
"url": "https://www.rcsb.org/structure/2H6F",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2H6G",
"url": "https://www.rcsb.org/structure/2H6G",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2H6H",
"url": "https://www.rcsb.org/structure/2H6H",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2H6I",
"url": "https://www.rcsb.org/structure/2H6I",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2IEJ",
"url": "https://www.rcsb.org/structure/2IEJ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3E37",
"url": "https://www.rcsb.org/structure/3E37",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF01239",
"url": "http://pfam.xfam.org/family/PF01239",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P49354",
"url": "https://pharos.nih.gov/targets/P49354",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P49354",
"url": "http://purl.obolibrary.org/obo/PR_P49354",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_002018",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "13345",
"url": "https://www.rhea-db.org/rhea/13345",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "21240",
"url": "https://www.rhea-db.org/rhea/21240",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "B3KVN2",
"url": "https://www.uniprot.org/uniprot/B3KVN2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "B3KVN2-1",
"url": "https://www.uniprot.org/uniprot/B3KVN2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PK84",
"url": "https://www.uniprot.org/uniprot/E9PK84",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PK84-1",
"url": "https://www.uniprot.org/uniprot/E9PK84-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PN85",
"url": "https://www.uniprot.org/uniprot/E9PN85",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PN85-1",
"url": "https://www.uniprot.org/uniprot/E9PN85-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PPM9",
"url": "https://www.uniprot.org/uniprot/E9PPM9",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PPM9-1",
"url": "https://www.uniprot.org/uniprot/E9PPM9-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PQP6",
"url": "https://www.uniprot.org/uniprot/E9PQP6",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PQP6-1",
"url": "https://www.uniprot.org/uniprot/E9PQP6-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0YCW1",
"url": "https://www.uniprot.org/uniprot/H0YCW1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0YCW1-1",
"url": "https://www.uniprot.org/uniprot/H0YCW1-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P49354-1",
"url": "https://www.uniprot.org/uniprot/P49354-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P49354-2",
"url": "https://www.uniprot.org/uniprot/P49354-2",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ",
"length": 379,
"header": "sp|P49354-1|FNTA_HUMAN Isoform 1 of Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1 CANONICAL=P49354-1"
},
"isoforms": [
{
"isoform_ac": "B3KVN2-1",
"url": "",
"sequence": {
"sequence": "MNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ",
"length": 228,
"header": "tr|B3KVN2-1|B3KVN2_HUMAN Computationally mapped isoform of Farnesyltransferase, CAAX box, alpha, isoform CRA_c OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1 CANONICAL=P49354-1"
},
"locus": {
"chromosome": "8",
"start_pos": 43085279,
"end_pos": 43069607,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000529687.5",
"url": "https://www.ensembl.org/id/ENST00000529687.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000473479.1",
"url": "https://www.ensembl.org/id/ENSP00000473479.1"
}
]
}
},
{
"isoform_ac": "E9PK84-1",
"url": "",
"sequence": {
"sequence": "MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYS",
"length": 67,
"header": "tr|E9PK84-1|E9PK84_HUMAN Computationally mapped isoform of Farnesyltransferase, CAAX box, alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1 CANONICAL=P49354-1"
},
"locus": {
"chromosome": "8",
"start_pos": 43064101,
"end_pos": 43056347,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000526755.5",
"url": "https://www.ensembl.org/id/ENST00000526755.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000437208.1",
"url": "https://www.ensembl.org/id/ENSP00000437208.1"
}
]
}
},
{
"isoform_ac": "E9PN85-1",
"url": "",
"sequence": {
"sequence": "MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWNLNFGIMSCSMWTNF",
"length": 117,
"header": "tr|E9PN85-1|E9PN85_HUMAN Computationally mapped isoform of Farnesyltransferase, CAAX box, alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1 CANONICAL=P49354-1"
},
"locus": {
"chromosome": "8",
"start_pos": 43077261,
"end_pos": 43056347,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000533998.5",
"url": "https://www.ensembl.org/id/ENST00000533998.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000432892.1",
"url": "https://www.ensembl.org/id/ENSP00000432892.1"
}
]
}
},
{
"isoform_ac": "E9PPM9-1",
"url": "",
"sequence": {
"sequence": "MNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQ",
"length": 60,
"header": "tr|E9PPM9-1|FNTA_HUMAN Computationally mapped isoform of Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1 CANONICAL=P49354-1"
},
"locus": {
"chromosome": "8",
"start_pos": 43072307,
"end_pos": 43069607,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000525699.5",
"url": "https://www.ensembl.org/id/ENST00000525699.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000436998.1",
"url": "https://www.ensembl.org/id/ENSP00000436998.1"
}
]
}
},
{
"isoform_ac": "E9PQP6-1",
"url": "",
"sequence": {
"sequence": "MSVFRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYL",
"length": 249,
"header": "tr|E9PQP6-1|E9PQP6_HUMAN Computationally mapped isoform of Farnesyltransferase, CAAX box, alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1 CANONICAL=P49354-1"
},
"locus": {
"chromosome": "8",
"start_pos": 43084797,
"end_pos": 43059078,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000533336.1",
"url": "https://www.ensembl.org/id/ENST00000533336.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000434430.1",
"url": "https://www.ensembl.org/id/ENSP00000434430.1"
}
]
}
},
{
"isoform_ac": "H0YCW1-1",
"url": "",
"sequence": {
"sequence": "GVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFK",
"length": 196,
"header": "tr|H0YCW1-1|H0YCW1_HUMAN Computationally mapped isoform of Farnesyltransferase, CAAX box, alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=8 CANONICAL=P49354-1"
},
"locus": {
"chromosome": "8",
"start_pos": 43077224,
"end_pos": 43056362,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000531266.5",
"url": "https://www.ensembl.org/id/ENST00000531266.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000432411.1",
"url": "https://www.ensembl.org/id/ENSP00000432411.1"
}
]
}
},
{
"isoform_ac": "P49354-1",
"url": "",
"sequence": {
"sequence": "MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ",
"length": 379,
"header": "sp|P49354-1|FNTA_HUMAN Isoform 1 of Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1 CANONICAL=P49354-1"
},
"locus": {
"chromosome": "8",
"start_pos": 43085279,
"end_pos": 43056347,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000302279.8",
"url": "https://www.ensembl.org/id/ENST00000302279.8"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000303423.3",
"url": "https://www.ensembl.org/id/ENSP00000303423.3"
}
]
}
},
{
"isoform_ac": "P49354-2",
"url": "",
"sequence": {
"sequence": "MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ",
"length": 312,
"header": "sp|P49354-2|FNTA_HUMAN Isoform 2 of Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1 CANONICAL=P49354-1"
},
"locus": {}
}
],
"glycosylation": [],
"phosphorylation": [
{
"start_pos": 373,
"end_pos": 373,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
},
{
"database": "iPTMnet",
"id": "P49354",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49354"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
},
{
"database": "phospho.ELM",
"id": "P49354",
"url": "http://phospho.elm.eu.org/byAccession/P49354.html"
}
],
"site_lbl": "Ser373"
}
],
"glycation": [],
"keywords": [
"enzyme"
],
"publication": [
{
"title": "Molecular characterization of a third member of the guanylyl cyclase-activating protein subfamily.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Haeseleer F, Sokal I, Li N, Pettenati M, Rao N, Bronson D, Wechter R, Baehr W, Palczewski K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "10037746",
"url": "https://glygen.org/publication/PubMed/10037746"
}
]
},
{
"title": "The GTPase activating factor for transducin in rod photoreceptors is the complex between RGS9 and type 5 G protein beta subunit.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1999",
"authors": "Makino ER, Handy JW, Li T, Arshavsky VY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "10051575",
"url": "https://glygen.org/publication/PubMed/10051575"
}
]
},
{
"title": "Cloning and characterization of a mammalian prenyl protein-specific protease.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Otto JC, Kim E, Young SG, Casey PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "10085068",
"url": "https://glygen.org/publication/PubMed/10085068"
}
]
},
{
"title": "Disruption of the mouse Rce1 gene results in defective Ras processing and mislocalization of Ras within cells.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Kim E, Ambroziak P, Otto JC, Taylor B, Ashby M, Shannon K, Casey PJ, Young SG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "10085069",
"url": "https://glygen.org/publication/PubMed/10085069"
}
]
},
{
"title": "Molecular and ligand-binding characterization of the sigma-receptor in the Jurkat human T lymphocyte cell line.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "1999",
"authors": "Ganapathy ME, Prasad PD, Huang W, Seth P, Leibach FH, Ganapathy V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "10087012",
"url": "https://glygen.org/publication/PubMed/10087012"
}
]
},
{
"title": "The adenomatous polyposis coli protein and retinoblastoma protein are cleaved early in apoptosis and are potential substrates for caspases.",
"journal": "Cell death and differentiation",
"date": "1998",
"authors": "Browne SJ, MacFarlane M, Cohen GM, Paraskeva C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "10200466",
"url": "https://glygen.org/publication/PubMed/10200466"
}
]
},
{
"title": "Caspases: their intracellular localization and translocation during apoptosis.",
"journal": "Cell death and differentiation",
"date": "1999",
"authors": "Zhivotovsky B, Samali A, Gahm A, Orrenius S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "10453075",
"url": "https://glygen.org/publication/PubMed/10453075"
}
]
},
{
"title": "Acinus is a caspase-3-activated protein required for apoptotic chromatin condensation.",
"journal": "Nature",
"date": "1999",
"authors": "Sahara S, Aoto M, Eguchi Y, Imamoto N, Yoneda Y, Tsujimoto Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "10490026",
"url": "https://glygen.org/publication/PubMed/10490026"
}
]
},
{
"title": "Structure, alternative splicing, and expression of the human RGS9 gene.",
"journal": "Gene",
"date": "1999",
"authors": "Zhang K, Howes KA, He W, Bronson JD, Pettenati MJ, Chen C, Palczewski K, Wensel TG, Baehr W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "10564809",
"url": "https://glygen.org/publication/PubMed/10564809"
}
]
},
{
"title": "Selective inhibition of ras-transformed cell growth by a novel fatty acid-based chloromethyl ketone designed to target Ras endoprotease.",
"journal": "Annals of the New York Academy of Sciences",
"date": "1999",
"authors": "Chen Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "10667208",
"url": "https://glygen.org/publication/PubMed/10667208"
}
]
},
{
"title": "Slowed recovery of rod photoresponse in mice lacking the GTPase accelerating protein RGS9-1.",
"journal": "Nature",
"date": "2000",
"authors": "Chen CK, Burns ME, He W, Wensel TG, Baylor DA, Simon MI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "10676965",
"url": "https://glygen.org/publication/PubMed/10676965"
}
]
},
{
"title": "Human ras-converting enzyme (hRCE1) endoproteolytic activity on K-ras-derived peptides.",
"journal": "Analytical biochemistry",
"date": "2000",
"authors": "Hollander I, Frommer E, Mallon R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "11038283",
"url": "https://glygen.org/publication/PubMed/11038283"
}
]
},
{
"title": "c-IAP1 is cleaved by caspases to produce a proapoptotic C-terminal fragment.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Clem RJ, Sheu TT, Richter BW, He WW, Thornberry NA, Duckett CS, Hardwick JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "11106668",
"url": "https://glygen.org/publication/PubMed/11106668"
}
]
},
{
"title": "The farnesyl transferase inhibitor SCH 66336 induces a G(2) --> M or G(1) pause in sensitive human tumor cell lines.",
"journal": "Experimental cell research",
"date": "2001",
"authors": "Ashar HR, James L, Gray K, Carr D, McGuirk M, Maxwell E, Black S, Armstrong L, Doll RJ, Taveras AG, Bishop WR, Kirschmeier P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "11120601",
"url": "https://glygen.org/publication/PubMed/11120601"
}
]
},
{
"title": "Characterization of the antitumor effects of the selective farnesyl protein transferase inhibitor R115777 in vivo and in vitro.",
"journal": "Cancer research",
"date": "2001",
"authors": "End DW, Smets G, Todd AV, Applegate TL, Fuery CJ, Angibaud P, Venet M, Sanz G, Poignet H, Skrzat S, Devine A, Wouters W, Bowden C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "11196150",
"url": "https://glygen.org/publication/PubMed/11196150"
}
]
},
{
"title": "Proteolytic activation of ETK/Bmx tyrosine kinase by caspases.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Wu YM, Huang CL, Kung HJ, Huang CY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "11278797",
"url": "https://glygen.org/publication/PubMed/11278797"
}
]
},
{
"title": "Phosphorylation of RGS9-1 by an endogenous protein kinase in rod outer segments.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Hu G, Jang GF, Cowan CW, Wensel TG, Palczewski K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "11292825",
"url": "https://glygen.org/publication/PubMed/11292825"
}
]
},
{
"title": "Inactivation of farnesyltransferase and geranylgeranyltransferase I by caspase-3: cleavage of the common alpha subunit during apoptosis.",
"journal": "Oncogene",
"date": "2001",
"authors": "Kim KW, Chung HH, Chung CW, Kim IK, Miura M, Wang S, Zhu H, Moon KD, Rha GB, Park JH, Jo DG, Woo HN, Song YH, Kim BJ, Yuan J, Jung YK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "11313965",
"url": "https://glygen.org/publication/PubMed/11313965"
}
]
},
{
"title": "SATB1 cleavage by caspase 6 disrupts PDZ domain-mediated dimerization, causing detachment from chromatin early in T-cell apoptosis.",
"journal": "Molecular and cellular biology",
"date": "2001",
"authors": "Galande S, Dickinson LA, Mian IS, Sikorska M, Kohwi-Shigematsu T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "11463840",
"url": "https://glygen.org/publication/PubMed/11463840"
}
]
},
{
"title": "Calmodulin binds to K-Ras, but not to H- or N-Ras, and modulates its downstream signaling.",
"journal": "Molecular and cellular biology",
"date": "2001",
"authors": "Villalonga P, Lopez-Alcala C, Bosch M, Chiloeches A, Rocamora N, Gil J, Marais R, Marshall CJ, Bachs O, Agell N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "11585916",
"url": "https://glygen.org/publication/PubMed/11585916"
}
]
},
{
"title": "Phosphorylation of the regulator of G protein signaling RGS9-1 by protein kinase A is a potential mechanism of light- and Ca2+-mediated regulation of G protein function in photoreceptors.",
"journal": "Biochemistry",
"date": "2001",
"authors": "Balasubramanian N, Levay K, Keren-Raifman T, Faurobert E, Slepak VZ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "11601986",
"url": "https://glygen.org/publication/PubMed/11601986"
}
]
},
{
"title": "The crystal structure of human protein farnesyltransferase reveals the basis for inhibition by CaaX tetrapeptides and their mimetics.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "2001",
"authors": "Long SB, Hancock PJ, Kral AM, Hellinga HW, Beese LS",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "11687658",
"url": "https://glygen.org/publication/PubMed/11687658"
}
]
},
{
"title": "Normal light response, photoreceptor integrity, and rhodopsin dephosphorylation in mice lacking both protein phosphatases with EF hands (PPEF-1 and PPEF-2).",
"journal": "Molecular and cellular biology",
"date": "2001",
"authors": "Ramulu P, Kennedy M, Xiong WH, Williams J, Cowan M, Blesh D, Yau KW, Hurley JB, Nathans J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "11713293",
"url": "https://glygen.org/publication/PubMed/11713293"
}
]
},
{
"title": "Absence of the CAAX endoprotease Rce1: effects on cell growth and transformation.",
"journal": "Molecular and cellular biology",
"date": "2002",
"authors": "Bergo MO, Ambroziak P, Gregory C, George A, Otto JC, Kim E, Nagase H, Casey PJ, Balmain A, Young SG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "11739732",
"url": "https://glygen.org/publication/PubMed/11739732"
}
]
},
{
"title": "Cloning of MASK, a novel member of the mammalian germinal center kinase III subfamily, with apoptosis-inducing properties.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Dan I, Ong SE, Watanabe NM, Blagoev B, Nielsen MM, Kajikawa E, Kristiansen TZ, Mann M, Pandey A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "11741893",
"url": "https://glygen.org/publication/PubMed/11741893"
}
]
},
{
"title": "Characterization of human GRK7 as a potential cone opsin kinase.",
"journal": "Molecular vision",
"date": "2001",
"authors": "Chen CK, Zhang K, Church-Kopish J, Huang W, Zhang H, Chen YJ, Frederick JM, Baehr W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "11754336",
"url": "https://glygen.org/publication/PubMed/11754336"
}
]
},
{
"title": "3-aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.",
"journal": "J. Med. Chem.",
"date": "2002",
"authors": "Bell IM, Gallicchio SN, Abrams M, Beese LS, Beshore DC, Bhimnathwala H, Bogusky MJ, Buser CA, Culberson JC, Davide J, Ellis-Hutchings M, Fernandes C, Gibbs JB, Graham SL, Hamilton KA, Hartman GD, Heimbrook DC, Homnick CF, Huber HE, Huff JR, Kassahun K, Koblan KS, Kohl NE, Lobell RB, Lynch JJ Jr, Robinson R, Rodrigues AD, Taylor JS, Walsh ES, Williams TM, Zartman CB",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "12036349",
"url": "https://glygen.org/publication/PubMed/12036349"
}
]
},
{
"title": "Caspase activation of mammalian sterile 20-like kinase 3 (Mst3). Nuclear translocation and induction of apoptosis.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Huang CY, Wu YM, Hsu CY, Lee WS, Lai MD, Lu TJ, Huang CL, Leu TH, Shih HM, Fang HI, Robinson DR, Kung HJ, Yuan CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "12107159",
"url": "https://glygen.org/publication/PubMed/12107159"
}
]
},
{
"title": "R9AP, a membrane anchor for the photoreceptor GTPase accelerating protein, RGS9-1.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2002",
"authors": "Hu G, Wensel TG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "12119397",
"url": "https://glygen.org/publication/PubMed/12119397"
}
]
},
{
"title": "Hematologic effects of inactivating the Ras processing enzyme Rce1.",
"journal": "Blood",
"date": "2003",
"authors": "Aiyagari AL, Taylor BR, Aurora V, Young SG, Shannon KM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "12433685",
"url": "https://glygen.org/publication/PubMed/12433685"
}
]
},
{
"title": "Identification of protein kinase C isozymes responsible for the phosphorylation of photoreceptor-specific RGS9-1 at Ser475.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Sokal I, Hu G, Liang Y, Mao M, Wensel TG, Palczewski K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "12499365",
"url": "https://glygen.org/publication/PubMed/12499365"
}
]
},
{
"title": "Caspase cleavage product of BAP31 induces mitochondrial fission through endoplasmic reticulum calcium signals, enhancing cytochrome c release to the cytosol.",
"journal": "The Journal of cell biology",
"date": "2003",
"authors": "Breckenridge DG, Stojanovic M, Marcellus RC, Shore GC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "12668660",
"url": "https://glygen.org/publication/PubMed/12668660"
}
]
},
{
"title": "Ca2+/calmodulin binds and dissociates K-RasB from membrane.",
"journal": "Biochemical and biophysical research communications",
"date": "2003",
"authors": "Sidhu RS, Clough RR, Bhullar RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "12727204",
"url": "https://glygen.org/publication/PubMed/12727204"
}
]
},
{
"title": "Targeting Ras signaling through inhibition of carboxyl methylation: an unexpected property of methotrexate.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2003",
"authors": "Winter-Vann AM, Kamen BA, Bergo MO, Young SG, Melnyk S, James SJ, Casey PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "12750467",
"url": "https://glygen.org/publication/PubMed/12750467"
}
]
},
{
"title": "Dual protein farnesyltransferase-geranylgeranyltransferase-I inhibitors as potential cancer chemotherapeutic agents.",
"journal": "J. Med. Chem.",
"date": "2003",
"authors": "deSolms SJ, Ciccarone TM, MacTough SC, Shaw AW, Buser CA, Ellis-Hutchings M, Fernandes C, Hamilton KA, Huber HE, Kohl NE, Lobell RB, Robinson RG, Tsou NN, Walsh ES, Graham SL, Beese LS, Taylor JS",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "12825937",
"url": "https://glygen.org/publication/PubMed/12825937"
}
]
},
{
"title": "Molecular cloning of a retina-specific membrane guanylyl cyclase.",
"journal": "Neuron",
"date": "1992",
"authors": "Shyjan AW, de Sauvage FJ, Gillett NA, Goeddel DV, Lowe DG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "1356371",
"url": "https://glygen.org/publication/PubMed/1356371"
}
]
},
{
"title": "Human rod photoreceptor cGMP-gated channel: amino acid sequence, gene structure, and functional expression.",
"journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience",
"date": "1992",
"authors": "Dhallan RS, Macke JP, Eddy RL, Shows TB, Reed RR, Yau KW, Nathans J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "1379636",
"url": "https://glygen.org/publication/PubMed/1379636"
}
]
},
{
"title": "Isolation of human retinal genes: recoverin cDNA and gene.",
"journal": "Biochemical and biophysical research communications",
"date": "1992",
"authors": "Murakami A, Yajima T, Inana G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "1387789",
"url": "https://glygen.org/publication/PubMed/1387789"
}
]
},
{
"title": "Lipid modification at the N terminus of photoreceptor G-protein alpha-subunit.",
"journal": "Nature",
"date": "1992",
"authors": "Kokame K, Fukada Y, Yoshizawa T, Takao T, Shimonishi Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "1436039",
"url": "https://glygen.org/publication/PubMed/1436039"
}
]
},
{
"title": "Photoreceptor cGMP phosphodiesterase delta subunit (PDEdelta) functions as a prenyl-binding protein.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Zhang H, Liu XH, Zhang K, Chen CK, Frederick JM, Prestwich GD, Baehr W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "14561760",
"url": "https://glygen.org/publication/PubMed/14561760"
}
]
},
{
"title": "Carboxyl methylation of Ras regulates membrane targeting and effector engagement.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Chiu VK, Silletti J, Dinsell V, Wiener H, Loukeris K, Ou G, Philips MR, Pillinger MH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "14660603",
"url": "https://glygen.org/publication/PubMed/14660603"
}
]
},
{
"title": "Defects in RGS9 or its anchor protein R9AP in patients with slow photoreceptor deactivation.",
"journal": "Nature",
"date": "2004",
"authors": "Nishiguchi KM, Sandberg MA, Kooijman AC, Martemyanov KA, Pott JW, Hagstrom SA, Arshavsky VY, Berson EL, Dryja TP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "14702087",
"url": "https://glygen.org/publication/PubMed/14702087"
}
]
},
{
"title": "Inactivation of Icmt inhibits transformation by oncogenic K-Ras and B-Raf.",
"journal": "The Journal of clinical investigation",
"date": "2004",
"authors": "Bergo MO, Gavino BJ, Hong C, Beigneux AP, McMahon M, Casey PJ, Young SG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "14966563",
"url": "https://glygen.org/publication/PubMed/14966563"
}
]
},
{
"title": "Crystal structures of the anticancer clinical candidates R115777 (Tipifarnib) and BMS-214662 complexed with protein farnesyltransferase suggest a mechanism of FTI selectivity.",
"journal": "Biochemistry",
"date": "2004",
"authors": "Beese L.S., Reid T.S.",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"reference": [
{
"type": "PubMed",
"id": "15170324",
"url": "https://glygen.org/publication/PubMed/15170324"
}
]
},
{
"title": "Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.",
"journal": "J. Mol. Biol.",
"date": "2004",
"authors": "Reid TS, Terry KL, Casey PJ, Beese LS",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "15451670",
"url": "https://glygen.org/publication/PubMed/15451670"
}
]
},
{
"title": "Postprenylation CAAX processing is required for proper localization of Ras but not Rho GTPases.",
"journal": "Molecular biology of the cell",
"date": "2005",
"authors": "Michaelson D, Ali W, Chiu VK, Bergo M, Silletti J, Wright L, Young SG, Philips M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "15659645",
"url": "https://glygen.org/publication/PubMed/15659645"
}
]
},
{
"title": "Phosphorylation of GRK1 and GRK7 by cAMP-dependent protein kinase attenuates their enzymatic activities.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Horner TJ, Osawa S, Schaller MD, Weiss ER",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "15946941",
"url": "https://glygen.org/publication/PubMed/15946941"
}
]
},
{
"title": "DHHC9 and GCP16 constitute a human protein fatty acyltransferase with specificity for H- and N-Ras.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Swarthout JT, Lobo S, Farh L, Croke MR, Greentree WK, Deschenes RJ, Linder ME",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "16000296",
"url": "https://glygen.org/publication/PubMed/16000296"
}
]
},
{
"title": "Reversible intracellular translocation of KRas but not HRas in hippocampal neurons regulated by Ca2+/calmodulin.",
"journal": "The Journal of cell biology",
"date": "2005",
"authors": "Fivaz M, Meyer T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "16043511",
"url": "https://glygen.org/publication/PubMed/16043511"
}
]
},
{
"title": "Chloroquine is a potent inhibitor of SARS coronavirus infection and spread.",
"journal": "Virology journal",
"date": "2005",
"authors": "Vincent MJ, Bergeron E, Benjannet S, Erickson BR, Rollin PE, Ksiazek TG, Seidah NG, Nichol ST",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "16115318",
"url": "https://glygen.org/publication/PubMed/16115318"
}
]
},
{
"title": "Cleavage of claspin by caspase-7 during apoptosis inhibits the Chk1 pathway.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Clarke CA, Bennett LN, Clarke PR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "16123041",
"url": "https://glygen.org/publication/PubMed/16123041"
}
]
},
{
"title": "Structural basis for the functional differences between type I and type II human methionine aminopeptidases.",
"journal": "Biochemistry",
"date": "2005",
"authors": "Addlagatta A, Hu X, Liu JO, Matthews BW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "16274222",
"url": "https://glygen.org/publication/PubMed/16274222"
}
]
},
{
"title": "PKC regulates a farnesyl-electrostatic switch on K-Ras that promotes its association with Bcl-XL on mitochondria and induces apoptosis.",
"journal": "Molecular cell",
"date": "2006",
"authors": "Bivona TG, Quatela SE, Bodemann BO, Ahearn IM, Soskis MJ, Mor A, Miura J, Wiener HH, Wright L, Saba SG, Yim D, Fein A, Perez de Castro I, Li C, Thompson CB, Cox AD, Philips MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "16483930",
"url": "https://glygen.org/publication/PubMed/16483930"
}
]
},
{
"title": "Chronic antidepressants potentiate via sigma-1 receptors the brain-derived neurotrophic factor-induced signaling for glutamate release.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Yagasaki Y, Numakawa T, Kumamaru E, Hayashi T, Su TP, Kunugi H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "16522641",
"url": "https://glygen.org/publication/PubMed/16522641"
}
]
},
{
"title": "Conversion of protein farnesyltransferase to a geranylgeranyltransferase.",
"journal": "Biochemistry",
"date": "2006",
"authors": "Terry KL, Casey PJ, Beese LS",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"reference": [
{
"type": "PubMed",
"id": "16893176",
"url": "https://glygen.org/publication/PubMed/16893176"
}
]
},
{
"title": "Transducin subunit stoichiometry and cellular distribution in rod outer segments.",
"journal": "Cell biology international",
"date": "2006",
"authors": "Clack JW, Springmeyer ML, Clark CR, Witzmann FA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "16895762",
"url": "https://glygen.org/publication/PubMed/16895762"
}
]
},
{
"title": "RGS expression rate-limits recovery of rod photoresponses.",
"journal": "Neuron",
"date": "2006",
"authors": "Krispel CM, Chen D, Melling N, Chen YJ, Martemyanov KA, Quillinan N, Arshavsky VY, Wensel TG, Chen CK, Burns ME",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "16908407",
"url": "https://glygen.org/publication/PubMed/16908407"
}
]
},
{
"title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.",
"journal": "Nat. Biotechnol.",
"date": "2006",
"authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "UniProtKB",
"id": "B3KVN2",
"url": "https://www.uniprot.org/uniprot/B3KVN2"
}
],
"reference": [
{
"type": "PubMed",
"id": "16964243",
"url": "https://glygen.org/publication/PubMed/16964243"
}
]
},
{
"title": "Activation of Rho-associated coiled-coil protein kinase 1 (ROCK-1) by caspase-3 cleavage plays an essential role in cardiac myocyte apoptosis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2006",
"authors": "Chang J, Xie M, Shah VR, Schneider MD, Entman ML, Wei L, Schwartz RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "16983089",
"url": "https://glygen.org/publication/PubMed/16983089"
}
]
},
{
"title": "Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2006",
"authors": "Hu X, Addlagatta A, Lu J, Matthews BW, Liu JO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "17114291",
"url": "https://glygen.org/publication/PubMed/17114291"
}
]
},
{
"title": "Caspase cleavage of the APC tumor suppressor and release of an amino-terminal domain is required for the transcription-independent function of APC in apoptosis.",
"journal": "Oncogene",
"date": "2007",
"authors": "Qian J, Steigerwald K, Combs KA, Barton MC, Groden J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "17297457",
"url": "https://glygen.org/publication/PubMed/17297457"
}
]
},
{
"title": "Highly potent inhibitors of methionine aminopeptidase-2 based on a 1,2,4-triazole pharmacophore.",
"journal": "Journal of medicinal chemistry",
"date": "2007",
"authors": "Marino JP Jr, Fisher PW, Hofmann GA, Kirkpatrick RB, Janson CA, Johnson RK, Ma C, Mattern M, Meek TD, Ryan MD, Schulz C, Smith WW, Tew DG, Tomazek TA Jr, Veber DF, Xiong WC, Yamamoto Y, Yamashita K, Yang G, Thompson SK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "17636946",
"url": "https://glygen.org/publication/PubMed/17636946"
}
]
},
{
"title": "High occupancy of sigma-1 receptors in the human brain after single oral administration of fluvoxamine: a positron emission tomography study using [11C]SA4503.",
"journal": "Biological psychiatry",
"date": "2007",
"authors": "Ishikawa M, Ishiwata K, Ishii K, Kimura Y, Sakata M, Naganawa M, Oda K, Miyatake R, Fujisaki M, Shimizu E, Shirayama Y, Iyo M, Hashimoto K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "17662961",
"url": "https://glygen.org/publication/PubMed/17662961"
}
]
},
{
"title": "Identification of essential interacting elements in K-Ras/calmodulin binding and its role in K-Ras localization.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Lopez-Alcala C, Alvarez-Moya B, Villalonga P, Calvo M, Bachs O, Agell N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "18182391",
"url": "https://glygen.org/publication/PubMed/18182391"
}
]
},
{
"title": "Inactivating Icmt ameliorates K-RAS-induced myeloproliferative disease.",
"journal": "Blood",
"date": "2008",
"authors": "Wahlstrom AM, Cutts BA, Liu M, Lindskog A, Karlsson C, Sjogren AK, Andersson KM, Young SG, Bergo MO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "18502828",
"url": "https://glygen.org/publication/PubMed/18502828"
}
]
},
{
"title": "A quantitative atlas of mitotic phosphorylation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2008",
"authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "iPTMnet",
"id": "P49354-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49354-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
}
]
},
{
"title": "Phosphorylation of GRK7 by PKA in cone photoreceptor cells is regulated by light.",
"journal": "Journal of neurochemistry",
"date": "2008",
"authors": "Osawa S, Jo R, Weiss ER",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "18803695",
"url": "https://glygen.org/publication/PubMed/18803695"
}
]
},
{
"title": "USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Burrows JF, Kelvin AA, McFarlane C, Burden RE, McGrattan MJ, De la Vega M, Govender U, Quinn DJ, Dib K, Gadina M, Scott CJ, Johnston JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "19188362",
"url": "https://glygen.org/publication/PubMed/19188362"
}
]
},
{
"title": "Structural basis for binding and selectivity of antimalarial and anticancer ethylenediamine inhibitors to protein farnesyltransferase.",
"journal": "Chem. Biol.",
"date": "2009",
"authors": "Hast MA, Fletcher S, Cummings CG, Pusateri EE, Blaskovich MA, Rivas K, Gelb MH, Van Voorhis WC, Sebti SM, Hamilton AD, Beese LS",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"reference": [
{
"type": "PubMed",
"id": "19246009",
"url": "https://glygen.org/publication/PubMed/19246009"
}
]
},
{
"title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.",
"journal": "Analytical chemistry",
"date": "2009",
"authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S",
"evidence": [
{
"database": "iPTMnet",
"id": "P49354-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49354-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
]
},
{
"title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2009",
"authors": "Pan C, Olsen JV, Daub H, Mann M",
"evidence": [
{
"database": "iPTMnet",
"id": "P49354-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49354-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
]
},
{
"title": "Novel mutations and electrophysiologic findings in RGS9- and R9AP-associated retinal dysfunction (Bradyopsia).",
"journal": "Ophthalmology",
"date": "2010",
"authors": "Michaelides M, Li Z, Rana NA, Richardson EC, Hykin PG, Moore AT, Holder GE, Webster AR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "19818506",
"url": "https://glygen.org/publication/PubMed/19818506"
}
]
},
{
"title": "A photoreceptor calcium binding protein is recognized by autoantibodies obtained from patients with cancer-associated retinopathy.",
"journal": "The Journal of cell biology",
"date": "1991",
"authors": "Polans AS, Buczylko J, Crabb J, Palczewski K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "1999465",
"url": "https://glygen.org/publication/PubMed/1999465"
}
]
},
{
"title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.",
"journal": "Science signaling",
"date": "2010",
"authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "iPTMnet",
"id": "P49354-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49354-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
]
},
{
"title": "Identification of a primary target of thalidomide teratogenicity.",
"journal": "Science (New York, N.Y.)",
"date": "2010",
"authors": "Ito T, Ando H, Suzuki T, Ogura T, Hotta K, Imamura Y, Yamaguchi Y, Handa H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "20223979",
"url": "https://glygen.org/publication/PubMed/20223979"
}
]
},
{
"title": "The palmitoylation machinery is a spatially organizing system for peripheral membrane proteins.",
"journal": "Cell",
"date": "2010",
"authors": "Rocks O, Gerauer M, Vartak N, Koch S, Huang ZP, Pechlivanis M, Kuhlmann J, Brunsveld L, Chandra A, Ellinger B, Waldmann H, Bastiaens PI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "20416930",
"url": "https://glygen.org/publication/PubMed/20416930"
}
]
},
{
"title": "Small-molecule inhibition of APT1 affects Ras localization and signaling.",
"journal": "Nature chemical biology",
"date": "2010",
"authors": "Dekker FJ, Rocks O, Vartak N, Menninger S, Hedberg C, Balamurugan R, Wetzel S, Renner S, Gerauer M, Scholermann B, Rusch M, Kramer JW, Rauh D, Coates GW, Brunsveld L, Bastiaens PI, Waldmann H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "20418879",
"url": "https://glygen.org/publication/PubMed/20418879"
}
]
},
{
"title": "Lessons from photoreceptors: turning off g-protein signaling in living cells.",
"journal": "Physiology (Bethesda, Md.)",
"date": "2010",
"authors": "Burns ME, Pugh EN Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "20430952",
"url": "https://glygen.org/publication/PubMed/20430952"
}
]
},
{
"title": "Inhibition of isoprenylcysteine carboxylmethyltransferase induces autophagic-dependent apoptosis and impairs tumor growth.",
"journal": "Oncogene",
"date": "2010",
"authors": "Wang M, Hossain MS, Tan W, Coolman B, Zhou J, Liu S, Casey PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "20622895",
"url": "https://glygen.org/publication/PubMed/20622895"
}
]
},
{
"title": "K-Ras4B phosphorylation at Ser181 is inhibited by calmodulin and modulates K-Ras activity and function.",
"journal": "Oncogene",
"date": "2010",
"authors": "Alvarez-Moya B, Lopez-Alcala C, Drosten M, Bachs O, Agell N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "20802526",
"url": "https://glygen.org/publication/PubMed/20802526"
}
]
},
{
"title": "Calmodulin methyltransferase is an evolutionarily conserved enzyme that trimethylates Lys-115 in calmodulin.",
"journal": "Nature communications",
"date": "2010",
"authors": "Magnani R, Dirk LM, Trievel RC, Houtz RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "20975703",
"url": "https://glygen.org/publication/PubMed/20975703"
}
]
},
{
"title": "Endocytic sorting and recycling require membrane phosphatidylserine asymmetry maintained by TAT-1/CHAT-1.",
"journal": "PLoS genetics",
"date": "2010",
"authors": "Chen B, Jiang Y, Zeng S, Yan J, Li X, Zhang Y, Zou W, Wang X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "21170358",
"url": "https://glygen.org/publication/PubMed/21170358"
}
]
},
{
"title": "Discovery and SAR of methylated tetrahydropyranyl derivatives as inhibitors of isoprenylcysteine carboxyl methyltransferase (ICMT).",
"journal": "Journal of medicinal chemistry",
"date": "2011",
"authors": "Judd WR, Slattum PM, Hoang KC, Bhoite L, Valppu L, Alberts G, Brown B, Roth B, Ostanin K, Huang L, Wettstein D, Richards B, Willardsen JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "21661760",
"url": "https://glygen.org/publication/PubMed/21661760"
}
]
},
{
"title": "Therapeutic strategies for targeting ras proteins.",
"journal": "Genes & cancer",
"date": "2011",
"authors": "Gysin S, Salt M, Young A, McCormick F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "21779505",
"url": "https://glygen.org/publication/PubMed/21779505"
}
]
},
{
"title": "Development of highly potent inhibitors of the Ras-targeting human acyl protein thioesterases based on substrate similarity design.",
"journal": "Angewandte Chemie (International ed. in English)",
"date": "2011",
"authors": "Hedberg C, Dekker FJ, Rusch M, Renner S, Wetzel S, Vartak N, Gerding-Reimers C, Bon RS, Bastiaens PI, Waldmann H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "21905185",
"url": "https://glygen.org/publication/PubMed/21905185"
}
]
},
{
"title": "Identification of acyl protein thioesterases 1 and 2 as the cellular targets of the Ras-signaling modulators palmostatin B and M.",
"journal": "Angewandte Chemie (International ed. in English)",
"date": "2011",
"authors": "Rusch M, Zimmermann TJ, Burger M, Dekker FJ, Gormer K, Triola G, Brockmeyer A, Janning P, Bottcher T, Sieber SA, Vetter IR, Hedberg C, Waldmann H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "21905186",
"url": "https://glygen.org/publication/PubMed/21905186"
}
]
},
{
"title": "Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.",
"journal": "Nature chemical biology",
"date": "2011",
"authors": "Ismail SA, Chen YX, Rusinova A, Chandra A, Bierbaum M, Gremer L, Triola G, Waldmann H, Bastiaens PI, Wittinghofer A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "22002721",
"url": "https://glygen.org/publication/PubMed/22002721"
}
]
},
{
"title": "Inhibiting the palmitoylation/depalmitoylation cycle selectively reduces the growth of hematopoietic cells expressing oncogenic Nras.",
"journal": "Blood",
"date": "2012",
"authors": "Xu J, Hedberg C, Dekker FJ, Li Q, Haigis KM, Hwang E, Waldmann H, Shannon K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "22144181",
"url": "https://glygen.org/publication/PubMed/22144181"
}
]
},
{
"title": "The GDI-like solubilizing factor PDEdelta sustains the spatial organization and signalling of Ras family proteins.",
"journal": "Nature cell biology",
"date": "2011",
"authors": "Chandra A, Grecco HE, Pisupati V, Perera D, Cassidy L, Skoulidis F, Ismail SA, Hedberg C, Hanzal-Bayer M, Venkitaraman AR, Wittinghofer A, Bastiaens PI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "22179043",
"url": "https://glygen.org/publication/PubMed/22179043"
}
]
},
{
"title": "Mechanism of isoprenylcysteine carboxyl methylation from the crystal structure of the integral membrane methyltransferase ICMT.",
"journal": "Molecular cell",
"date": "2011",
"authors": "Yang J, Kulkarni K, Manolaridis I, Zhang Z, Dodd RB, Mas-Droux C, Barford D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "22195972",
"url": "https://glygen.org/publication/PubMed/22195972"
}
]
},
{
"title": "An extension of hypotheses regarding rapid-acting, treatment-refractory, and conventional antidepressant activity of dextromethorphan and dextrorphan.",
"journal": "Medical hypotheses",
"date": "2012",
"authors": "Lauterbach EC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "22401777",
"url": "https://glygen.org/publication/PubMed/22401777"
}
]
},
{
"title": "Cereblon is a direct protein target for immunomodulatory and antiproliferative activities of lenalidomide and pomalidomide.",
"journal": "Leukemia",
"date": "2012",
"authors": "Lopez-Girona A, Mendy D, Ito T, Miller K, Gandhi AK, Kang J, Karasawa S, Carmel G, Jackson P, Abbasian M, Mahmoudi A, Cathers B, Rychak E, Gaidarova S, Chen R, Schafer PH, Handa H, Daniel TO, Evans JF, Chopra R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "22552008",
"url": "https://glygen.org/publication/PubMed/22552008"
}
]
},
{
"title": "A comprehensive survey of Ras mutations in cancer.",
"journal": "Cancer research",
"date": "2012",
"authors": "Prior IA, Lewis PD, Mattos C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "22589270",
"url": "https://glygen.org/publication/PubMed/22589270"
}
]
},
{
"title": "Speed, sensitivity, and stability of the light response in rod and cone photoreceptors: facts and models.",
"journal": "Progress in retinal and eye research",
"date": "2012",
"authors": "Korenbrot JI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "22658984",
"url": "https://glygen.org/publication/PubMed/22658984"
}
]
},
{
"title": "Dissociation of the K-Ras4B/PDEdelta complex upon contact with lipid membranes: membrane delivery instead of extraction.",
"journal": "Journal of the American Chemical Society",
"date": "2012",
"authors": "Weise K, Kapoor S, Werkmuller A, Mobitz S, Zimmermann G, Triola G, Waldmann H, Winter R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "22721555",
"url": "https://glygen.org/publication/PubMed/22721555"
}
]
},
{
"title": "An overview of tubulin inhibitors that interact with the colchicine binding site.",
"journal": "Pharmaceutical research",
"date": "2012",
"authors": "Lu Y, Chen J, Xiao M, Li W, Miller DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "22814904",
"url": "https://glygen.org/publication/PubMed/22814904"
}
]
},
{
"title": "Functionalized indoleamines as potent, drug-like inhibitors of isoprenylcysteine carboxyl methyltransferase (Icmt).",
"journal": "European journal of medicinal chemistry",
"date": "2013",
"authors": "Ramanujulu PM, Yang T, Yap SQ, Wong FC, Casey PJ, Wang M, Go ML",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "23514631",
"url": "https://glygen.org/publication/PubMed/23514631"
}
]
},
{
"title": "From alpha4beta2 Nicotinic Ligands to the Discovery of sigma1 Receptor Ligands: Pharmacophore Analysis and Rational Design.",
"journal": "ACS medicinal chemistry letters",
"date": "2012",
"authors": "Yu LF, Zhang HK, Gunosewoyo H, Kozikowski AP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "23641311",
"url": "https://glygen.org/publication/PubMed/23641311"
}
]
},
{
"title": "Small molecule inhibition of the KRAS-PDEdelta interaction impairs oncogenic KRAS signalling.",
"journal": "Nature",
"date": "2013",
"authors": "Zimmermann G, Papke B, Ismail S, Vartak N, Chandra A, Hoffmann M, Hahn SA, Triola G, Wittinghofer A, Bastiaens PI, Waldmann H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "23698361",
"url": "https://glygen.org/publication/PubMed/23698361"
}
]
},
{
"title": "Oncogenic K-ras segregates at spatially distinct plasma membrane signaling platforms according to its phosphorylation status.",
"journal": "Journal of cell science",
"date": "2013",
"authors": "Barcelo C, Paco N, Beckett AJ, Alvarez-Moya B, Garrido E, Gelabert M, Tebar F, Jaumot M, Prior I, Agell N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "23943869",
"url": "https://glygen.org/publication/PubMed/23943869"
}
]
},
{
"title": "Marine natural products: bryostatins in preclinical and clinical studies.",
"journal": "Pharmaceutical biology",
"date": "2014",
"authors": "Kollar P, Rajchard J, Balounova Z, Pazourek J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "24033119",
"url": "https://glygen.org/publication/PubMed/24033119"
}
]
},
{
"title": "4-Acyl pyrroles: mimicking acetylated lysines in histone code reading.",
"journal": "Angewandte Chemie (International ed. in English)",
"date": "2013",
"authors": "Lucas X, Wohlwend D, Hugle M, Schmidtkunz K, Gerhardt S, Schule R, Jung M, Einsle O, Gunther S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "24272870",
"url": "https://glygen.org/publication/PubMed/24272870"
}
]
},
{
"title": "An unbiased proteomic screen reveals caspase cleavage is positively and negatively regulated by substrate phosphorylation.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2014",
"authors": "Turowec JP, Zukowski SA, Knight JD, Smalley DM, Graves LM, Johnson GL, Li SS, Lajoie GA, Litchfield DW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "24556848",
"url": "https://glygen.org/publication/PubMed/24556848"
}
]
},
{
"title": "Dual kinase-bromodomain inhibitors for rationally designed polypharmacology.",
"journal": "Nature chemical biology",
"date": "2014",
"authors": "Ciceri P, Muller S, O'Mahony A, Fedorov O, Filippakopoulos P, Hunt JP, Lasater EA, Pallares G, Picaud S, Wells C, Martin S, Wodicka LM, Shah NP, Treiber DK, Knapp S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "24584101",
"url": "https://glygen.org/publication/PubMed/24584101"
}
]
},
{
"title": "KRas localizes to the plasma membrane by spatial cycles of solubilization, trapping and vesicular transport.",
"journal": "Cell",
"date": "2014",
"authors": "Schmick M, Vartak N, Papke B, Kovacevic M, Truxius DC, Rossmannek L, Bastiaens PIH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "24725411",
"url": "https://glygen.org/publication/PubMed/24725411"
}
]
},
{
"title": "An improved isoprenylcysteine carboxylmethyltransferase inhibitor induces cancer cell death and attenuates tumor growth in vivo.",
"journal": "Cancer biology & therapy",
"date": "2014",
"authors": "Lau HY, Ramanujulu PM, Guo D, Yang T, Wirawan M, Casey PJ, Go ML, Wang M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "24971579",
"url": "https://glygen.org/publication/PubMed/24971579"
}
]
},
{
"title": "The catalytic subunit of phosphatase 2A dephosphorylates phosphoopsin.",
"journal": "Biochemistry",
"date": "1989",
"authors": "Palczewski K, Hargrave PA, McDowell JH, Ingebritsen TS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "2540796",
"url": "https://glygen.org/publication/PubMed/2540796"
}
]
},
{
"title": "Regulation of rhodopsin dephosphorylation by arrestin.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Palczewski K, McDowell JH, Jakes S, Ingebritsen TS, Hargrave PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "2550422",
"url": "https://glygen.org/publication/PubMed/2550422"
}
]
},
{
"title": "Membrane protein transport in photoreceptors: the function of PDEdelta: the Proctor lecture.",
"journal": "Investigative ophthalmology & visual science",
"date": "2014",
"authors": "Baehr W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "25550383",
"url": "https://glygen.org/publication/PubMed/25550383"
}
]
},
{
"title": "Interplay of phosphorylation and dephosphorylation in vision: protein phosphatases of bovine rod outer segments.",
"journal": "Biochemistry",
"date": "1989",
"authors": "Fowles C, Akhtar M, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "2558719",
"url": "https://glygen.org/publication/PubMed/2558719"
}
]
},
{
"title": "Mechanisms of membrane binding of small GTPase K-Ras4B farnesylated hypervariable region.",
"journal": "The Journal of biological chemistry",
"date": "2015",
"authors": "Jang H, Abraham SJ, Chavan TS, Hitchinson B, Khavrutskii L, Tarasova NI, Nussinov R, Gaponenko V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "25713064",
"url": "https://glygen.org/publication/PubMed/25713064"
}
]
},
{
"title": "Ras moves to stay in place.",
"journal": "Trends in cell biology",
"date": "2015",
"authors": "Schmick M, Kraemer A, Bastiaens PI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "25759176",
"url": "https://glygen.org/publication/PubMed/25759176"
}
]
},
{
"title": "Ras activation revisited: role of GEF and GAP systems.",
"journal": "Biological chemistry",
"date": "2015",
"authors": "Hennig A, Markwart R, Esparza-Franco MA, Ladds G, Rubio I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "25781681",
"url": "https://glygen.org/publication/PubMed/25781681"
}
]
},
{
"title": "Structure guided design of potent and selective ponatinib-based hybrid inhibitors for RIPK1.",
"journal": "Cell reports",
"date": "2015",
"authors": "Najjar M, Suebsuwong C, Ray SS, Thapa RJ, Maki JL, Nogusa S, Shah S, Saleh D, Gough PJ, Bertin J, Yuan J, Balachandran S, Cuny GD, Degterev A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "25801024",
"url": "https://glygen.org/publication/PubMed/25801024"
}
]
},
{
"title": "CC-122, a pleiotropic pathway modifier, mimics an interferon response and has antitumor activity in DLBCL.",
"journal": "Blood",
"date": "2015",
"authors": "Hagner PR, Man HW, Fontanillo C, Wang M, Couto S, Breider M, Bjorklund C, Havens CG, Lu G, Rychak E, Raymon H, Narla RK, Barnes L, Khambatta G, Chiu H, Kosek J, Kang J, Amantangelo MD, Waldman M, Lopez-Girona A, Cai T, Pourdehnad M, Trotter M, Daniel TO, Schafer PH, Klippel A, Thakurta A, Chopra R, Gandhi AK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "26002965",
"url": "https://glygen.org/publication/PubMed/26002965"
}
]
},
{
"title": "The Key Role of Calmodulin in KRAS-Driven Adenocarcinomas.",
"journal": "Molecular cancer research : MCR",
"date": "2015",
"authors": "Nussinov R, Muratcioglu S, Tsai CJ, Jang H, Gursoy A, Keskin O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "26085527",
"url": "https://glygen.org/publication/PubMed/26085527"
}
]
},
{
"title": "K-Ras Promotes Tumorigenicity through Suppression of Non-canonical Wnt Signaling.",
"journal": "Cell",
"date": "2015",
"authors": "Wang MT, Holderfield M, Galeas J, Delrosario R, To MD, Balmain A, McCormick F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "26590425",
"url": "https://glygen.org/publication/PubMed/26590425"
}
]
},
{
"title": "All ras proteins are polyisoprenylated but only some are palmitoylated.",
"journal": "Cell",
"date": "1989",
"authors": "Hancock JF, Magee AI, Childs JE, Marshall CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "2661017",
"url": "https://glygen.org/publication/PubMed/2661017"
}
]
},
{
"title": "ABHD17 proteins are novel protein depalmitoylases that regulate N-Ras palmitate turnover and subcellular localization.",
"journal": "eLife",
"date": "2015",
"authors": "Lin DT, Conibear E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "26701913",
"url": "https://glygen.org/publication/PubMed/26701913"
}
]
},
{
"title": "Inhibition of isoprenylcysteine carboxylmethyltransferase augments BCR-ABL1 tyrosine kinase inhibition-induced apoptosis in chronic myeloid leukemia.",
"journal": "Experimental hematology",
"date": "2016",
"authors": "Sun WT, Xiang W, Ng BL, Asari K, Bunte RM, Casey PJ, Wang M, Chuah C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "26706195",
"url": "https://glygen.org/publication/PubMed/26706195"
}
]
},
{
"title": "Acyl protein thioesterase 1 and 2 (APT-1, APT-2) inhibitors palmostatin B, ML348 and ML349 have different effects on NRAS mutant melanoma cells.",
"journal": "Oncotarget",
"date": "2016",
"authors": "Vujic I, Sanlorenzo M, Esteve-Puig R, Vujic M, Kwong A, Tsumura A, Murphy R, Moy A, Posch C, Monshi B, Rappersberger K, Ortiz-Urda S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "26771141",
"url": "https://glygen.org/publication/PubMed/26771141"
}
]
},
{
"title": "p21ras is modified by a farnesyl isoprenoid.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1989",
"authors": "Casey PJ, Solski PA, Der CJ, Buss JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "2682646",
"url": "https://glygen.org/publication/PubMed/2682646"
}
]
},
{
"title": "Identification of pyrazolopyridazinones as PDEdelta inhibitors.",
"journal": "Nature communications",
"date": "2016",
"authors": "Papke B, Murarka S, Vogel HA, Martin-Gago P, Kovacevic M, Truxius DC, Fansa EK, Ismail S, Zimmermann G, Heinelt K, Schultz-Fademrecht C, Al Saabi A, Baumann M, Nussbaumer P, Wittinghofer A, Waldmann H, Bastiaens PI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "27094677",
"url": "https://glygen.org/publication/PubMed/27094677"
}
]
},
{
"title": "Drugging Ras GTPase: a comprehensive mechanistic and signaling structural view.",
"journal": "Chemical Society reviews",
"date": "2016",
"authors": "Lu S, Jang H, Gu S, Zhang J, Nussinov R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "27396271",
"url": "https://glygen.org/publication/PubMed/27396271"
}
]
},
{
"title": "Regulation of K-Ras4B Membrane Binding by Calmodulin.",
"journal": "Biophysical journal",
"date": "2016",
"authors": "Sperlich B, Kapoor S, Waldmann H, Winter R, Weise K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "27410739",
"url": "https://glygen.org/publication/PubMed/27410739"
}
]
},
{
"title": "AMPK and Endothelial Nitric Oxide Synthase Signaling Regulates K-Ras Plasma Membrane Interactions via Cyclic GMP-Dependent Protein Kinase 2.",
"journal": "Molecular and cellular biology",
"date": "2016",
"authors": "Cho KJ, Casteel DE, Prakash P, Tan L, van der Hoeven D, Salim AA, Kim C, Capon RJ, Lacey E, Cunha SR, Gorfe AA, Hancock JF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "27697864",
"url": "https://glygen.org/publication/PubMed/27697864"
}
]
},
{
"title": "Structural basis of recognition of farnesylated and methylated KRAS4b by PDEdelta.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2016",
"authors": "Dharmaiah S, Bindu L, Tran TH, Gillette WK, Frank PH, Ghirlando R, Nissley DV, Esposito D, McCormick F, Stephen AG, Simanshu DK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "27791178",
"url": "https://glygen.org/publication/PubMed/27791178"
}
]
},
{
"title": "Inhibition of Isoprenylcysteine Carboxylmethyltransferase Induces Cell-Cycle Arrest and Apoptosis through p21 and p21-Regulated BNIP3 Induction in Pancreatic Cancer.",
"journal": "Molecular cancer therapeutics",
"date": "2017",
"authors": "Manu KA, Chai TF, Teh JT, Zhu WL, Casey PJ, Wang M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "28167504",
"url": "https://glygen.org/publication/PubMed/28167504"
}
]
},
{
"title": "A Cereblon Modulator (CC-220) with Improved Degradation of Ikaros and Aiolos.",
"journal": "Journal of medicinal chemistry",
"date": "2018",
"authors": "Matyskiela ME, Zhang W, Man HW, Muller G, Khambatta G, Baculi F, Hickman M, LeBrun L, Pagarigan B, Carmel G, Lu CC, Lu G, Riley M, Satoh Y, Schafer P, Daniel TO, Carmichael J, Cathers BE, Chamberlain PP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "28425720",
"url": "https://glygen.org/publication/PubMed/28425720"
}
]
},
{
"title": "Targeting the Ras palmitoylation/depalmitoylation cycle in cancer.",
"journal": "Biochemical Society transactions",
"date": "2017",
"authors": "Lin DTS, Davis NG, Conibear E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "28630138",
"url": "https://glygen.org/publication/PubMed/28630138"
}
]
},
{
"title": "RAS Proteins and Their Regulators in Human Disease.",
"journal": "Cell",
"date": "2017",
"authors": "Simanshu DK, Nissley DV, McCormick F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "28666118",
"url": "https://glygen.org/publication/PubMed/28666118"
}
]
},
{
"title": "Targeting Ras with Macromolecules.",
"journal": "Cold Spring Harbor perspectives in medicine",
"date": "2018",
"authors": "Pei D, Chen K, Liao H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "28778966",
"url": "https://glygen.org/publication/PubMed/28778966"
}
]
},
{
"title": "Posttranslational Modifications of RAS Proteins.",
"journal": "Cold Spring Harbor perspectives in medicine",
"date": "2018",
"authors": "Ahearn I, Zhou M, Philips MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "29311131",
"url": "https://glygen.org/publication/PubMed/29311131"
}
]
},
{
"title": "Rce1: mechanism and inhibition.",
"journal": "Critical reviews in biochemistry and molecular biology",
"date": "2018",
"authors": "Hampton SE, Dore TM, Schmidt WK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "29424242",
"url": "https://glygen.org/publication/PubMed/29424242"
}
]
},
{
"title": "Cereblon modulator iberdomide induces degradation of the transcription factors Ikaros and Aiolos: immunomodulation in healthy volunteers and relevance to systemic lupus erythematosus.",
"journal": "Annals of the rheumatic diseases",
"date": "2018",
"authors": "Schafer PH, Ye Y, Wu L, Kosek J, Ringheim G, Yang Z, Liu L, Thomas M, Palmisano M, Chopra R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "29945920",
"url": "https://glygen.org/publication/PubMed/29945920"
}
]
},
{
"title": "Rous sarcoma virus transforming protein lacking myristic acid phosphorylates known polypeptide substrates without inducing transformation.",
"journal": "Cell",
"date": "1986",
"authors": "Kamps MP, Buss JE, Sefton BM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "3006923",
"url": "https://glygen.org/publication/PubMed/3006923"
}
]
},
{
"title": "A First-in-Human Study of Novel Cereblon Modulator Avadomide (CC-122) in Advanced Malignancies.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2019",
"authors": "Rasco DW, Papadopoulos KP, Pourdehnad M, Gandhi AK, Hagner PR, Li Y, Wei X, Chopra R, Hege K, DiMartino J, Shih K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "30201761",
"url": "https://glygen.org/publication/PubMed/30201761"
}
]
},
{
"title": "Targeting RIPK1 for the treatment of human diseases.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2019",
"authors": "Degterev A, Ofengeim D, Yuan J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9679191",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191"
}
],
"reference": [
{
"type": "PubMed",
"id": "31048504",
"url": "https://glygen.org/publication/PubMed/31048504"
}
]
},
{
"title": "The sequence of human retinal S-antigen reveals similarities with alpha-transducin.",
"journal": "FEBS letters",
"date": "1988",
"authors": "Yamaki K, Tsuda M, Shinohara T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "3164688",
"url": "https://glygen.org/publication/PubMed/3164688"
}
]
},
{
"title": "Growth Factor Receptor Signaling Inhibition Prevents SARS-CoV-2 Replication.",
"journal": "Molecular cell",
"date": "2020",
"authors": "Klann K, Bojkova D, Tascher G, Ciesek S, Munch C, Cinatl J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "32877642",
"url": "https://glygen.org/publication/PubMed/32877642"
}
]
},
{
"title": "Cell-permeable CaaX-peptides affect K-Ras downstream signaling and promote cell death in cancer cells.",
"journal": "The FEBS journal",
"date": "2021",
"authors": "Klimpel A, Stillger K, Wiederstein JL, Kruger M, Neundorf I",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002018",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018"
}
],
"reference": [
{
"type": "PubMed",
"id": "33112492",
"url": "https://glygen.org/publication/PubMed/33112492"
}
]
},
{
"title": "Scaffold association factor B (SAFB) is required for expression of prenyltransferases and RAS membrane association.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2020",
"authors": "Zhou M, Kuruvilla L, Shi X, Viviano S, Ahearn IM, Amendola CR, Su W, Badri S, Mahaffey J, Fehrenbacher N, Skok J, Schlessinger J, Turk BE, Calderwood DA, Philips MR",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002018",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018"
}
],
"reference": [
{
"type": "PubMed",
"id": "33257571",
"url": "https://glygen.org/publication/PubMed/33257571"
}
]
},
{
"title": "Protein farnesylation is upregulated in Alzheimer's human brains and neuron-specific suppression of farnesyltransferase mitigates pathogenic processes in Alzheimer's model mice.",
"journal": "Acta neuropathologica communications",
"date": "2021",
"authors": "Jeong A, Cheng S, Zhong R, Bennett DA, Bergo MO, Li L",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002018",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002018"
}
],
"reference": [
{
"type": "PubMed",
"id": "34315531",
"url": "https://glygen.org/publication/PubMed/34315531"
}
]
},
{
"title": "Kinetics of rhodopsin bleaching in the isolated human retina.",
"journal": "The Journal of physiology",
"date": "1973",
"authors": "Baumann C, Bender S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "4772407",
"url": "https://glygen.org/publication/PubMed/4772407"
}
]
},
{
"title": "Flow of information in the light-triggered cyclic nucleotide cascade of vision.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1981",
"authors": "Fung BK, Hurley JB, Stryer L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "6264430",
"url": "https://glygen.org/publication/PubMed/6264430"
}
]
},
{
"title": "Interaction of calmodulin with the cyclic GMP-gated channel of rod photoreceptor cells. Modulation of activity, affinity purification, and localization.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Hsu YT, Molday RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525588",
"url": "https://glygen.org/publication/PubMed/7525588"
}
]
},
{
"title": "Subunit 2 (or beta) of retinal rod cGMP-gated cation channel is a component of the 240-kDa channel-associated protein and mediates Ca(2+)-calmodulin modulation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1994",
"authors": "Chen TY, Illing M, Molday LL, Hsu YT, Yau KW, Molday RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "7526403",
"url": "https://glygen.org/publication/PubMed/7526403"
}
]
},
{
"title": "Eukaryotic methionyl aminopeptidases: two classes of cobalt-dependent enzymes.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1995",
"authors": "Arfin SM, Kendall RL, Hall L, Weaver LH, Stewart AE, Matthews BW, Bradshaw RA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "7644482",
"url": "https://glygen.org/publication/PubMed/7644482"
}
]
},
{
"title": "A homozygous 1-base pair deletion in the arrestin gene is a frequent cause of Oguchi disease in Japanese.",
"journal": "Nature genetics",
"date": "1995",
"authors": "Fuchs S, Nakazawa M, Maw M, Tamai M, Oguchi Y, Gal A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "7670478",
"url": "https://glygen.org/publication/PubMed/7670478"
}
]
},
{
"title": "Modulation of the cGMP-gated channel of rod photoreceptor cells by calmodulin.",
"journal": "Nature",
"date": "1993",
"authors": "Hsu YT, Molday RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "7678445",
"url": "https://glygen.org/publication/PubMed/7678445"
}
]
},
{
"title": "A new subunit of the cyclic nucleotide-gated cation channel in retinal rods.",
"journal": "Nature",
"date": "1993",
"authors": "Chen TY, Peng YW, Dhallan RS, Ahamed B, Reed RR, Yau KW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "7682292",
"url": "https://glygen.org/publication/PubMed/7682292"
}
]
},
{
"title": "Cloning and expression of a second photoreceptor-specific membrane retina guanylyl cyclase (RetGC), RetGC-2.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1995",
"authors": "Lowe DG, Dizhoor AM, Liu K, Gu Q, Spencer M, Laura R, Lu L, Hurley JB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "7777544",
"url": "https://glygen.org/publication/PubMed/7777544"
}
]
},
{
"title": "Molecular characterization of human and mouse photoreceptor guanylate cyclase-activating protein (GCAP) and chromosomal localization of the human gene.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Subbaraya I, Ruiz CC, Helekar BS, Zhao X, Gorczyca WA, Pettenati MJ, Rao PN, Palczewski K, Baehr W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "7983048",
"url": "https://glygen.org/publication/PubMed/7983048"
}
]
},
{
"title": "cDNA cloning of the two subunits of human CAAX farnesyltransferase and chromosomal mapping of FNTA and FNTB loci and related sequences.",
"journal": "Genomics",
"date": "1993",
"authors": "Francke U., Milatovich A., Brown M.S., Goldstein J.L., Ozcelik T., Andres D.A., Wenzlau J.M.",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"reference": [
{
"type": "PubMed",
"id": "8276393",
"url": "https://glygen.org/publication/PubMed/8276393"
}
]
},
{
"title": "Mutational analysis of alpha-subunit of protein farnesyltransferase. Evidence for a catalytic role.",
"journal": "J. Biol. Chem.",
"date": "1993",
"authors": "Andres DA, Goldstein JL, Ho YK, Brown MS",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"reference": [
{
"type": "PubMed",
"id": "8419339",
"url": "https://glygen.org/publication/PubMed/8419339"
}
]
},
{
"title": "Characterization of recombinant human farnesyl-protein transferase: cloning, expression, farnesyl diphosphate binding, and functional homology with yeast prenyl-protein transferases.",
"journal": "Biochemistry",
"date": "1993",
"authors": "Omer CA, Kral AM, Diehl RE, Prendergast GC, Powers S, Allen CM, Gibbs JB, Kohl NE",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "8494894",
"url": "https://glygen.org/publication/PubMed/8494894"
}
]
},
{
"title": "Characterization of the G protein-coupled receptor kinase GRK4. Identification of four splice variants.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Premont RT, Macrae AD, Stoffel RH, Chung N, Pitcher JA, Ambrose C, Inglese J, MacDonald ME, Lefkowitz RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "8626439",
"url": "https://glygen.org/publication/PubMed/8626439"
}
]
},
{
"title": "Calcium-activated opsin phosphatase activity in retinal rod outer segments.",
"journal": "European journal of biochemistry",
"date": "1996",
"authors": "Kutuzov MA, Bennett N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "8706659",
"url": "https://glygen.org/publication/PubMed/8706659"
}
]
},
{
"title": "Characterization and chromosomal localization of the gene for human rhodopsin kinase.",
"journal": "Genomics",
"date": "1996",
"authors": "Khani SC, Abitbol M, Yamamoto S, Maravic-Magovcevic I, Dryja TP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "8812493",
"url": "https://glygen.org/publication/PubMed/8812493"
}
]
},
{
"title": "Proteolytic activation of protein kinase C delta by an ICE/CED 3-like protease induces characteristics of apoptosis.",
"journal": "The Journal of experimental medicine",
"date": "1996",
"authors": "Ghayur T, Hugunin M, Talanian RV, Ratnofsky S, Quinlan C, Emoto Y, Pandey P, Datta R, Huang Y, Kharbanda S, Allen H, Kamen R, Wong W, Kufe D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "8976194",
"url": "https://glygen.org/publication/PubMed/8976194"
}
]
},
{
"title": "The human GCAP1 and GCAP2 genes are arranged in a tail-to-tail array on the short arm of chromosome 6 (p21.1).",
"journal": "Genomics",
"date": "1997",
"authors": "Surguchov A, Bronson JD, Banerjee P, Knowles JA, Ruiz C, Subbaraya I, Palczewski K, Baehr W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "9119368",
"url": "https://glygen.org/publication/PubMed/9119368"
}
]
},
{
"title": "Caspase-3-mediated cleavage of protein kinase C theta in induction of apoptosis.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Datta R, Kojima H, Yoshida K, Kufe D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "9252332",
"url": "https://glygen.org/publication/PubMed/9252332"
}
]
},
{
"title": "Cleavage of focal adhesion kinase by caspases during apoptosis.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Wen LP, Fahrni JA, Troie S, Guan JL, Orth K, Rosen GD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "9325343",
"url": "https://glygen.org/publication/PubMed/9325343"
}
]
},
{
"title": "Human N-myristoyltransferase amino-terminal domain involved in targeting the enzyme to the ribosomal subcellular fraction.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Glover CJ, Hartman KD, Felsted RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "9353336",
"url": "https://glygen.org/publication/PubMed/9353336"
}
]
},
{
"title": "Molecular cloning, expression, and characterization of a novel human serine/threonine protein phosphatase, PP7, that is homologous to Drosophila retinal degeneration C gene product (rdgC).",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Huang X, Honkanen RE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "9430683",
"url": "https://glygen.org/publication/PubMed/9430683"
}
]
},
{
"title": "The proteolytic cleavage of protein kinase C isotypes, which generates kinase and regulatory fragments, correlates with Fas-mediated and 12-O-tetradecanoyl-phorbol-13-acetate-induced apoptosis.",
"journal": "European journal of biochemistry",
"date": "1997",
"authors": "Mizuno K, Noda K, Araki T, Imaoka T, Kobayashi Y, Akita Y, Shimonaka M, Kishi S, Ohno S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "9431985",
"url": "https://glygen.org/publication/PubMed/9431985"
}
]
},
{
"title": "Establishment of a human pancreatic tumor xenograft model: potential application for preclinical evaluation of novel therapeutic agents.",
"journal": "Pancreas",
"date": "1998",
"authors": "Mohammad RM, Dugan MC, Mohamed AN, Almatchy VP, Flake TM, Dergham ST, Shields AF, Al-Katib AA, Vaitkevicius VK, Sarkar FH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "9436858",
"url": "https://glygen.org/publication/PubMed/9436858"
}
]
},
{
"title": "RGS9, a GTPase accelerator for phototransduction.",
"journal": "Neuron",
"date": "1998",
"authors": "He W, Cowan CW, Wensel TG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "9459445",
"url": "https://glygen.org/publication/PubMed/9459445"
}
]
},
{
"title": "A second mammalian N-myristoyltransferase.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Giang DK, Cravatt BF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2514859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859"
}
],
"reference": [
{
"type": "PubMed",
"id": "9506952",
"url": "https://glygen.org/publication/PubMed/9506952"
}
]
},
{
"title": "Antitumor activity of SCH 66336, an orally bioavailable tricyclic inhibitor of farnesyl protein transferase, in human tumor xenograft models and wap-ras transgenic mice.",
"journal": "Cancer research",
"date": "1998",
"authors": "Liu M, Bryant MS, Chen J, Lee S, Yaremko B, Lipari P, Malkowski M, Ferrari E, Nielsen L, Prioli N, Dell J, Sinha D, Syed J, Korfmacher WA, Nomeir AA, Lin CC, Wang L, Taveras AG, Doll RJ, Njoroge FG, Mallams AK, Remiszewski S, Catino JJ, Girijavallabhan VM, Bishop WR, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "9810004",
"url": "https://glygen.org/publication/PubMed/9810004"
}
]
},
{
"title": "(+)-4-[2-[4-(8-Chloro-3,10-dibromo-6,11-dihydro-5H-benzo[5, 6]cyclohepta[1,2-b]- pyridin-11(R)-yl)-1-piperidinyl]-2-oxo-ethyl]-1-piperidinecarboxamid e (SCH-66336): a very potent farnesyl protein transferase inhibitor as a novel antitumor agent.",
"journal": "Journal of medicinal chemistry",
"date": "1998",
"authors": "Njoroge FG, Taveras AG, Kelly J, Remiszewski S, Mallams AK, Wolin R, Afonso A, Cooper AB, Rane DF, Liu YT, Wong J, Vibulbhan B, Pinto P, Deskus J, Alvarez CS, del Rosario J, Connolly M, Wang J, Desai J, Rossman RR, Bishop WR, Patton R, Wang L, Kirschmeier P, Ganguly AK, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "9822558",
"url": "https://glygen.org/publication/PubMed/9822558"
}
]
},
{
"title": "Inhibition of K-ras-transformed rodent and human cancer cell growth via induction of apoptosis by irreversible inhibitors of Ras endoprotease.",
"journal": "Cancer letters",
"date": "1998",
"authors": "Chen Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9648002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002"
}
],
"reference": [
{
"type": "PubMed",
"id": "9851253",
"url": "https://glygen.org/publication/PubMed/9851253"
}
]
},
{
"title": "Caspase-mediated cleavage of APC results in an amino-terminal fragment with an intact armadillo repeat domain.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "1999",
"authors": "Webb SJ, Nicholson D, Bubb VJ, Wyllie AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-111465",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465"
}
],
"reference": [
{
"type": "PubMed",
"id": "9973322",
"url": "https://glygen.org/publication/PubMed/9973322"
}
]
}
],
"pathway": [
{
"id": "hsa:2339",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2339",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-111465",
"name": "Apoptotic cleavage of cellular proteins",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111465",
"resource": "Reactome",
"description": "Apoptotic cleavage of cellular proteins"
},
{
"id": "R-HSA-2514859",
"name": "Inactivation, recovery and regulation of the phototransduction cascade",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2514859",
"resource": "Reactome",
"description": "Inactivation, recovery and regulation of the phototransduction cascade"
},
{
"id": "R-HSA-9648002",
"name": "RAS processing",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002",
"resource": "Reactome",
"description": "RAS processing"
},
{
"id": "R-HSA-9679191",
"name": "Potential therapeutics for SARS",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191",
"resource": "Reactome",
"description": "Potential therapeutics for SARS"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "Q04631-1",
"protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha",
"gene_name": "Fnta",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MAATEGVGESAPGGEPGQPEQPPPPPPPPPAQQPQEEEMAAEAGEAAASPMDDGFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRESDIPASV",
"length": 377
},
"evidence": [
{
"id": "45236668",
"url": "http://www.informatics.jax.org/homology/45236668",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "Q61239-1",
"protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha",
"gene_name": "Fnta",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MAATEGVGESAAGGEPGQPEQPPPPPPPPPAQQPQEEEMAAEAGEAAASPMDDGFLSLDSPTYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILSQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDVYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHCRESDIPASV",
"length": 377
},
"evidence": [
{
"id": "45236668",
"url": "http://www.informatics.jax.org/homology/45236668",
"database": "MGI"
},
{
"id": "P49354",
"url": "https://omabrowser.org/oma/group/P49354/",
"database": "OMA"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 10,
"go_terms": [
{
"name": "protein prenyltransferase activity",
"id": "GO:0008318",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008318",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "protein farnesyltransferase activity",
"id": "GO:0004660",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004660",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "protein geranylgeranyltransferase activity",
"id": "GO:0004661",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004661",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "CAAX-protein geranylgeranyltransferase activity",
"id": "GO:0004662",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004662",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "Rab geranylgeranyltransferase activity",
"id": "GO:0004663",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004663",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "acetylcholine receptor regulator activity",
"id": "GO:0030548",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030548",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "molecular adaptor activity",
"id": "GO:0060090",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060090",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "microtubule binding",
"id": "GO:0008017",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008017",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "receptor tyrosine kinase binding",
"id": "GO:0030971",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030971",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "alpha-tubulin binding",
"id": "GO:0043014",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043014",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 8,
"go_terms": [
{
"name": "protein prenylation",
"id": "GO:0018342",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018342",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "positive regulation of deacetylase activity",
"id": "GO:0090045",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090045",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "neurotransmitter receptor metabolic process",
"id": "GO:0045213",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045213",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "positive regulation of tubulin deacetylation",
"id": "GO:0090044",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090044",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "transforming growth factor beta receptor signaling pathway",
"id": "GO:0007179",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007179",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "protein farnesylation",
"id": "GO:0018343",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018343",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "protein geranylgeranylation",
"id": "GO:0018344",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018344",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "skeletal muscle acetylcholine-gated channel clustering",
"id": "GO:0071340",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071340",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 6,
"go_terms": [
{
"name": "CAAX-protein geranylgeranyltransferase complex",
"id": "GO:0005953",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005953",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "protein farnesyltransferase complex",
"id": "GO:0005965",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005965",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "cytoplasm",
"id": "GO:0005737",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "plasma membrane",
"id": "GO:0005886",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
},
{
"name": "microtubule associated complex",
"id": "GO:0005875",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005875",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 130,
"end_pos": 132,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 233,
"end_pos": 235,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 246,
"end_pos": 248,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 273,
"end_pos": 275,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 371,
"end_pos": 373,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "Phosphorylated. Phosphorylation is mediated by MUSK upon AGRIN stimulation and results in the activation of FNTA (By similarity).",
"evidence": [
{
"database": "UniProtKB",
"id": "P49354",
"url": "https://www.uniprot.org/uniprot/P49354"
},
{
"database": "PubMed",
"id": "Q61239",
"url": "https://glygen.org/publication/PubMed/Q61239"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "13345",
"name": "",
"equation": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q02293-1",
"Q04631-1",
"P49354-1",
"P49356-1",
"Q8K2I1-1",
"Q61239-1",
"P22007-1",
"P29703-1",
"Q55D51-1",
"Q54RT9-1",
"Q9VEV7-1"
],
"evidence": [
{
"id": "13345",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/13345"
}
]
},
{
"id": "21240",
"name": "",
"equation": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P53610-1",
"Q04631-1",
"Q08602-1",
"Q08603-1",
"A0A8I6AJR3-1",
"P49354-1",
"Q92696-1",
"P53609-1",
"P53611-1",
"Q61239-1",
"P53612-1",
"Q8BUY9-1",
"Q9JHK4-1",
"P18898-1",
"P20133-1",
"P29703-1",
"Q00618-1",
"Q55DA3-1",
"Q55DQ4-1",
"B0G172-1",
"Q54RT9-1",
"Q9VN77-1",
"Q9XZ68-1"
],
"evidence": [
{
"id": "21240",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/21240"
}
]
},
{
"id": "R-HSA-201640",
"name": "Caspase-mediated cleavage of farnesyltransferase/geranyl- geranyltransferase subunit alpha",
"equation": "",
"summary": "Farnesyltransferase/geranyl-geranyltransferase catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. This enzyme complex consists of a heterodimer of an alpha and a beta subunit. The alpha subunit is thought to function in the formation of a stable complex with the substrate. This alpha subnit is cleaved by caspase 3. Expression of the cleavage product (60-379) induces cell death (Kim et al., 2001).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-HSA-2530516"
],
"output_participant_list": [
"R-HSA-202869",
"R-HSA-202872"
],
"enzyme_list": [
"P49354-1",
"P42574-1"
],
"evidence": [
{
"id": "R-HSA-201640",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201640"
}
]
},
{
"id": "R-HSA-2530501",
"name": "FNTA:FNTB transfers FARN to GNGT1",
"equation": "",
"summary": "Prenylation is the process of post-translational addition of hydrophobic groups to proteins and is thought to help anchor proteins to cellular membranes. Farnesylation is a type of prenylation, where a farnesyl group (donated from farnesyl diphosphate, FPP) is added to a cysteine residue on a protein. The enzyme mediating this transfer is farnesyltransferase (FNT). FNT is a heterodimer comprising an alpha subunit (common to another prenylating enzyme called geranylgeranyltransferase, GGT) and a unique beta subunit (Long et al. 2001, Bell et al. 2002, deSolms et al. 2003). This complex recognises the CAAX box (C is the cysteine, A is any aliphatic amino acid, and X determines which enzyme acts on the protein) at the C-terminus of the target protein, in this case, the gamma subunit of transducin (GNG1) (Omer at al. 1993).",
"cellular_location": "cytosol, photoreceptor disc membrane",
"input_participant_list": [
"R-HSA-55393"
],
"output_participant_list": [
"R-HSA-2530520"
],
"enzyme_list": [
"P49354-1",
"P49356-1"
],
"evidence": [
{
"id": "R-HSA-2530501",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2530501"
}
]
},
{
"id": "R-HSA-9647978",
"name": "pro-RAS proteins are farnesylated",
"equation": "",
"summary": "RAS proteins are isoprenylated at a CaaX motif in the hypervariable region, where a is an aliphatic amino acid and X is any amino acid (Casey et al, 1989; Dharmaiah et al, 2016; reviewed in Ahean et al, 2018). Geranylgeranylation is favoured when X is leucine, while all other amino acids at this position favour farnesylation by farnesyltransferase (Casey et al, 1989; Reid et al, 2004).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [
"R-ALL-2530486"
],
"output_participant_list": [],
"enzyme_list": [
"P01111-1",
"P49354-1",
"P01112-1",
"P49356-1",
"P01116-1"
],
"evidence": [
{
"id": "R-HSA-9647978",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9647978"
}
]
},
{
"id": "R-HSA-9647987",
"name": "FNTB inhibitors bind FNTA:FNTB",
"equation": "",
"summary": "Because prenylation is important for RAS membrane localization and function, inhibition of this step of RAS processing was viewed as a promising early therapeutic target for RAS-driven cancers (reviewed in Gysin et al, 2011). Farnesyltransferase inhibitors such as lonafarnib and tipifarnib are small molecule CaaX competitive inhibitors that inhibit cell growth of a range of cancer cell lines and tumor xenografts (Njoroge et al, 1998; End et al, 2001; Liu et al, 1998; Ashar et al, 2001). Unfortunately, the clinical use of these drugs is hampered by the fact that both KRAS and NRAS can be geranylgeranylated when FTase is inhibited, restoring membrane localization and function (Fiordalisi et al, 2003). FTase inhibitors may have clinical use in the treatment of HRAS driven cancers, such as bladder and thyroid cancers (reviewed in Gysin et al, 2011; Lu et al, 2016).
Lonafarnib is a farnesyltransferase inhibitor of growth factor signalling that prevented SARS-CoV-2 replication in Caco-2 and UKF-RC-2 cells at clinically achievable concentrations (Klann et al, 2020).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P49354-1",
"P49356-1"
],
"evidence": [
{
"id": "R-HSA-9647987",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9647987"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-2530486",
"participant_name": "FPP [cytosol]",
"crossref": [
{
"id": "000013507236",
"database": "ZINC",
"url": ""
},
{
"id": "000012494625",
"database": "ZINC",
"url": ""
},
{
"id": "50277",
"database": "ChEBI",
"url": ""
},
{
"id": "000013507238",
"database": "ZINC",
"url": ""
},
{
"id": "000013507240",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0251465",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000013507236",
"database": "ZINC",
"url": ""
},
{
"id": "000012494625",
"database": "ZINC",
"url": ""
},
{
"id": "50277",
"database": "ChEBI",
"url": ""
},
{
"id": "000013507240",
"database": "ZINC",
"url": ""
},
{
"id": "000013507238",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0251465",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000013507236",
"database": "ZINC",
"url": ""
},
{
"id": "000012494625",
"database": "ZINC",
"url": ""
},
{
"id": "50277",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0251465",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000013507240",
"database": "ZINC",
"url": ""
},
{
"id": "000013507238",
"database": "ZINC",
"url": ""
},
{
"id": "000013507240",
"database": "ZINC",
"url": ""
},
{
"id": "50277",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0251465",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000013507236",
"database": "ZINC",
"url": ""
},
{
"id": "000013507238",
"database": "ZINC",
"url": ""
},
{
"id": "000012494625",
"database": "ZINC",
"url": ""
},
{
"id": "000012494625",
"database": "ZINC",
"url": ""
},
{
"id": "50277",
"database": "ChEBI",
"url": ""
},
{
"id": "000013507236",
"database": "ZINC",
"url": ""
},
{
"id": "000013507240",
"database": "ZINC",
"url": ""
},
{
"id": "000013507238",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0251465",
"database": "HMDB Metabolite",
"url": ""
}
]
},
{
"participant_id": "R-HSA-202869",
"participant_name": "FNTA(1-59) [cytosol]",
"crossref": [
{
"id": "P49354",
"database": "UniProt",
"url": ""
},
{
"id": "2H6H",
"database": "PDB",
"url": ""
},
{
"id": "1LD7",
"database": "PDB",
"url": ""
},
{
"id": "2H6I",
"database": "PDB",
"url": ""
},
{
"id": "1JCQ",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP01824",
"database": "HMDB Protein",
"url": ""
},
{
"id": "1S63",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000303423",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000168522",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000302279",
"database": "Ensembl",
"url": ""
},
{
"id": "1LD8",
"database": "PDB",
"url": ""
},
{
"id": "2IEJ",
"database": "PDB",
"url": ""
},
{
"id": "1MZC",
"database": "PDB",
"url": ""
},
{
"id": "3E37",
"database": "PDB",
"url": ""
},
{
"id": "2F0Y",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000168522",
"database": "OpenTargets",
"url": ""
},
{
"id": "1TN6",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000168522-FNTA",
"database": "HPA",
"url": ""
},
{
"id": "1SA4",
"database": "PDB",
"url": ""
},
{
"id": "P49354",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "NP_002018.1",
"database": "RefSeq",
"url": ""
},
{
"id": "2825",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "2H6G",
"database": "PDB",
"url": ""
},
{
"id": "P49354",
"database": "PRO",
"url": ""
},
{
"id": "P49354",
"database": "GeneCards",
"url": ""
},
{
"id": "2H6F",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-202872",
"participant_name": "FNTA(59-379) [cytosol]",
"crossref": [
{
"id": "P49354",
"database": "UniProt",
"url": ""
},
{
"id": "2H6H",
"database": "PDB",
"url": ""
},
{
"id": "1LD7",
"database": "PDB",
"url": ""
},
{
"id": "2H6I",
"database": "PDB",
"url": ""
},
{
"id": "1JCQ",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP01824",
"database": "HMDB Protein",
"url": ""
},
{
"id": "1S63",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000303423",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000168522",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000302279",
"database": "Ensembl",
"url": ""
},
{
"id": "1LD8",
"database": "PDB",
"url": ""
},
{
"id": "2IEJ",
"database": "PDB",
"url": ""
},
{
"id": "1MZC",
"database": "PDB",
"url": ""
},
{
"id": "3E37",
"database": "PDB",
"url": ""
},
{
"id": "2F0Y",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000168522",
"database": "OpenTargets",
"url": ""
},
{
"id": "1TN6",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000168522-FNTA",
"database": "HPA",
"url": ""
},
{
"id": "1SA4",
"database": "PDB",
"url": ""
},
{
"id": "P49354",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "NP_002018.1",
"database": "RefSeq",
"url": ""
},
{
"id": "2825",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "2H6G",
"database": "PDB",
"url": ""
},
{
"id": "P49354",
"database": "PRO",
"url": ""
},
{
"id": "P49354",
"database": "GeneCards",
"url": ""
},
{
"id": "2H6F",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2530516",
"participant_name": "FNTA(2-379) [cytosol]",
"crossref": [
{
"id": "ENSG00000168522",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENSP00000303423",
"database": "Ensembl",
"url": ""
},
{
"id": "P49354",
"database": "PRO",
"url": ""
},
{
"id": "2H6I",
"database": "PDB",
"url": ""
},
{
"id": "P49354",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "2IEJ",
"database": "PDB",
"url": ""
},
{
"id": "2H6H",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000168522-FNTA",
"database": "HPA",
"url": ""
},
{
"id": "ENST00000302279",
"database": "Ensembl",
"url": ""
},
{
"id": "2825",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "HMDBP01824",
"database": "HMDB Protein",
"url": ""
},
{
"id": "3E37",
"database": "PDB",
"url": ""
},
{
"id": "2H6F",
"database": "PDB",
"url": ""
},
{
"id": "2F0Y",
"database": "PDB",
"url": ""
},
{
"id": "1S63",
"database": "PDB",
"url": ""
},
{
"id": "2H6G",
"database": "PDB",
"url": ""
},
{
"id": "1LD7",
"database": "PDB",
"url": ""
},
{
"id": "1SA4",
"database": "PDB",
"url": ""
},
{
"id": "1LD8",
"database": "PDB",
"url": ""
},
{
"id": "P49354",
"database": "UniProt",
"url": ""
},
{
"id": "1MZC",
"database": "PDB",
"url": ""
},
{
"id": "NP_002018.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1JCQ",
"database": "PDB",
"url": ""
},
{
"id": "P49354",
"database": "GeneCards",
"url": ""
},
{
"id": "1TN6",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000168522",
"database": "Ensembl",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2530520",
"participant_name": "S-farn-GNGT1 [photoreceptor disc membrane]",
"crossref": [
{
"id": "P63211",
"database": "UniProt",
"url": ""
},
{
"id": "P63211",
"database": "GeneCards",
"url": ""
},
{
"id": "P63211",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "7L0S",
"database": "PDB",
"url": ""
},
{
"id": "NP_001316355.1",
"database": "RefSeq",
"url": ""
},
{
"id": "7L0R",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP08407",
"database": "HMDB Protein",
"url": ""
},
{
"id": "ENSG00000127928",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENSP00000248572",
"database": "Ensembl",
"url": ""
},
{
"id": "P63211",
"database": "PRO",
"url": ""
},
{
"id": "ENSP00000388777",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000429473",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000127928",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000248572",
"database": "Ensembl",
"url": ""
},
{
"id": "7L0Q",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000127928-GNGT1",
"database": "HPA",
"url": ""
},
{
"id": "7L0P",
"database": "PDB",
"url": ""
},
{
"id": "NP_068774.1",
"database": "RefSeq",
"url": ""
}
]
},
{
"participant_id": "R-HSA-55393",
"participant_name": "GNGT1 [photoreceptor disc membrane]",
"crossref": [
{
"id": "ENSP00000248572",
"database": "Ensembl",
"url": ""
},
{
"id": "7L0P",
"database": "PDB",
"url": ""
},
{
"id": "NP_001316355.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000127928",
"database": "Ensembl",
"url": ""
},
{
"id": "P63211",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSP00000388777",
"database": "Ensembl",
"url": ""
},
{
"id": "7L0Q",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP08407",
"database": "HMDB Protein",
"url": ""
},
{
"id": "P63211",
"database": "UniProt",
"url": ""
},
{
"id": "ENST00000429473",
"database": "Ensembl",
"url": ""
},
{
"id": "7L0S",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000127928-GNGT1",
"database": "HPA",
"url": ""
},
{
"id": "ENSG00000127928",
"database": "OpenTargets",
"url": ""
},
{
"id": "NP_068774.1",
"database": "RefSeq",
"url": ""
},
{
"id": "7L0R",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000248572",
"database": "Ensembl",
"url": ""
},
{
"id": "P63211",
"database": "GeneCards",
"url": ""
},
{
"id": "P63211",
"database": "PRO",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A0A8I6AJR3",
"gene_name": "ENSRNOG00000070626",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "A0A8I6AJR3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6AJR3"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "A0A8I6AJR3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6AJR3"
}
]
}
]
},
{
"uniprot_ac": "B0G172",
"gene_name": "rabggtb",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "B0G172",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B0G172"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "B0G172",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B0G172"
}
]
}
]
},
{
"uniprot_ac": "P01111",
"gene_name": "NRAS",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P01111",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P01111"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P01111",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P01111"
}
]
}
]
},
{
"uniprot_ac": "P01112",
"gene_name": "HRAS",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P01112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P01112"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P01112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P01112"
}
]
}
]
},
{
"uniprot_ac": "P01116",
"gene_name": "KRAS",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P01116",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P01116"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P01116",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P01116"
}
]
}
]
},
{
"uniprot_ac": "P18898",
"gene_name": "CDC43",
"activity": [
{
"ec_number": "2.5.1.59",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P18898",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18898"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "",
"evidence": [
{
"id": "P18898",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18898"
}
]
}
]
},
{
"uniprot_ac": "P20133",
"gene_name": "BET2",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P20133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20133"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "P20133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20133"
}
]
}
]
},
{
"uniprot_ac": "P22007",
"gene_name": "RAM1",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P22007",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22007"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "P22007",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22007"
}
]
}
]
},
{
"uniprot_ac": "P29703",
"gene_name": "RAM2",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P29703",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29703"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P29703",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29703"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "P29703",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29703"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "",
"evidence": [
{
"id": "P29703",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29703"
}
]
}
]
},
{
"uniprot_ac": "P42574",
"gene_name": "CASP3",
"activity": [
{
"ec_number": "3.4.22.56",
"activity": "Strict requirement for an Asp residue at positions P1 and P4. It has a preferred cleavage sequence of Asp-Xaa-Xaa-Asp-|- with a hydrophobic amino-acid residue at P2 and a hydrophilic amino-acid residue at P3, although Val or Ala are also accepted at this position.",
"evidence": [
{
"id": "P42574",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42574"
}
]
},
{
"ec_number": "3.4.22.56",
"activity": "",
"evidence": [
{
"id": "P42574",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42574"
}
]
}
]
},
{
"uniprot_ac": "P49354",
"gene_name": "FNTA",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P49354",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49354"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P49354",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49354"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "",
"evidence": [
{
"id": "P49354",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49354"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "P49354",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49354"
}
]
}
]
},
{
"uniprot_ac": "P49356",
"gene_name": "FNTB",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P49356",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49356"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "P49356",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49356"
}
]
}
]
},
{
"uniprot_ac": "P53609",
"gene_name": "PGGT1B",
"activity": [
{
"ec_number": "2.5.1.59",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P53609",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53609"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "",
"evidence": [
{
"id": "P53609",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53609"
}
]
}
]
},
{
"uniprot_ac": "P53610",
"gene_name": "Pggt1b",
"activity": [
{
"ec_number": "2.5.1.59",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P53610",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53610"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "",
"evidence": [
{
"id": "P53610",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53610"
}
]
}
]
},
{
"uniprot_ac": "P53611",
"gene_name": "RABGGTB",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P53611",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53611"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "P53611",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53611"
}
]
}
]
},
{
"uniprot_ac": "P53612",
"gene_name": "Rabggtb",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "P53612",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53612"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "P53612",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53612"
}
]
}
]
},
{
"uniprot_ac": "Q00618",
"gene_name": "BET4",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q00618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00618"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "Q00618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q00618"
}
]
}
]
},
{
"uniprot_ac": "Q02293",
"gene_name": "Fntb",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q02293",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02293"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "Q02293",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02293"
}
]
}
]
},
{
"uniprot_ac": "Q04631",
"gene_name": "Fnta",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q04631",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04631"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q04631",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04631"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "Q04631",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04631"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "",
"evidence": [
{
"id": "Q04631",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04631"
}
]
}
]
},
{
"uniprot_ac": "Q08602",
"gene_name": "Rabggta",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q08602",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08602"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "Q08602",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08602"
}
]
}
]
},
{
"uniprot_ac": "Q08603",
"gene_name": "Rabggtb",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q08603",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08603"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "Q08603",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08603"
}
]
}
]
},
{
"uniprot_ac": "Q54RT9",
"gene_name": "fntA",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q54RT9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54RT9"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q54RT9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54RT9"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "Q54RT9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54RT9"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "",
"evidence": [
{
"id": "Q54RT9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54RT9"
}
]
}
]
},
{
"uniprot_ac": "Q55D51",
"gene_name": "fntB",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q55D51",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55D51"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "Q55D51",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55D51"
}
]
}
]
},
{
"uniprot_ac": "Q55DA3",
"gene_name": "pggt1b",
"activity": [
{
"ec_number": "2.5.1.59",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q55DA3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55DA3"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "",
"evidence": [
{
"id": "Q55DA3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55DA3"
}
]
}
]
},
{
"uniprot_ac": "Q55DQ4",
"gene_name": "rabggta",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q55DQ4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55DQ4"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "Q55DQ4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55DQ4"
}
]
}
]
},
{
"uniprot_ac": "Q61239",
"gene_name": "Fnta",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q61239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61239"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q61239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61239"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "Q61239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61239"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "",
"evidence": [
{
"id": "Q61239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61239"
}
]
}
]
},
{
"uniprot_ac": "Q8BUY9",
"gene_name": "Pggt1b",
"activity": [
{
"ec_number": "2.5.1.59",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q8BUY9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8BUY9"
}
]
},
{
"ec_number": "2.5.1.59",
"activity": "",
"evidence": [
{
"id": "Q8BUY9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8BUY9"
}
]
}
]
},
{
"uniprot_ac": "Q8K2I1",
"gene_name": "Fntb",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q8K2I1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2I1"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "Q8K2I1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2I1"
}
]
}
]
},
{
"uniprot_ac": "Q92696",
"gene_name": "RABGGTA",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q92696",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92696"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "Q92696",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92696"
}
]
}
]
},
{
"uniprot_ac": "Q9JHK4",
"gene_name": "Rabggta",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q9JHK4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHK4"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "Q9JHK4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHK4"
}
]
}
]
},
{
"uniprot_ac": "Q9VEV7",
"gene_name": "Fntb",
"activity": [
{
"ec_number": "2.5.1.58",
"activity": "(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q9VEV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VEV7"
}
]
},
{
"ec_number": "2.5.1.58",
"activity": "",
"evidence": [
{
"id": "Q9VEV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VEV7"
}
]
}
]
},
{
"uniprot_ac": "Q9VN77",
"gene_name": "RabGGTa",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q9VN77",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VN77"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "Q9VN77",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VN77"
}
]
}
]
},
{
"uniprot_ac": "Q9XZ68",
"gene_name": "RabGGTb",
"activity": [
{
"ec_number": "2.5.1.60",
"activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].",
"evidence": [
{
"id": "Q9XZ68",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9XZ68"
}
]
},
{
"ec_number": "2.5.1.60",
"activity": "",
"evidence": [
{
"id": "Q9XZ68",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9XZ68"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 173
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}