{ "uniprot_canonical_ac": "P48758-1", "uniprot_ac": "P48758", "uniprot_id": "CBR1_MOUSE", "mass": { "chemical_mass": 30641.0, "monoisotopic_mass": 30641.0 }, "refseq": { "ac": "NP_031646", "name": "carbonyl reductase [NADPH] 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" }, "gene_names": [ { "name": "Cbr1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P48758", "id": "P48758" }, { "name": "Cbr1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646", "id": "NP_031646" }, { "name": "Cbr; CR; PG-9-KR", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646", "id": "NP_031646" }, { "name": "Cbr", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P48758", "id": "P48758" } ], "protein_names": [ { "name": "Carbonyl reductase [NADPH] 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P48758" }, { "name": "1.1.1.184", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "1.1.1.189", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "1.1.1.196", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "1.1.1.197", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "1.1.1.71", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "15-hydroxyprostaglandin dehydrogenase [NADP(+)]", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "20-beta-hydroxysteroid dehydrogenase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "Alcohol dehydrogenase [NAD(P)+] CBR1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "NADPH-dependent carbonyl reductase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "PG-9-KR", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "Prostaglandin 9-ketoreductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "Prostaglandin-E(2) 9-reductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48758" }, { "name": "alcohol dehydrogenase [NAD(P)+] CBR1; prostaglandin 9-ketoreductase; prostaglandin-E(2) 9-reductase; NADPH-dependent carbonyl reductase 1; 15-hydroxyprostaglandin dehydrogenase; Carbonyl reductase [NADPH] 1 (NADPH-dependent carbonyl reductase 1); 20-beta-hydroxysteroid dehydrogenase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646", "id": "NP_031646" }, { "name": "carbonyl reductase [NADPH] 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646", "id": "NP_031646" } ], "function": [ { "annotation": "CBR1 plays a critical role in controlling redox balance and detoxifying lipid peroxidation during muscle differentiation and regeneration.", "evidence": [ { "database": "RefSeq", "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" }, { "database": "PubMed", "id": "23732109", "url": "https://glygen.org/publication/PubMed/23732109" } ] }, { "annotation": "Carbonyl Reductase 1 Plays a Significant Role in Converting Doxorubicin to Cardiotoxic Doxorubicinol in Mouse Liver, but the Majority of the Doxorubicinol-Forming Activity Remains Unidentified.", "evidence": [ { "database": "RefSeq", "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" }, { "database": "PubMed", "id": "31955137", "url": "https://glygen.org/publication/PubMed/31955137" } ] }, { "annotation": "Carbonyl reductase 1 amplifies glucocorticoid action in adipose tissue and impairs glucose tolerance in lean mice.", "evidence": [ { "database": "RefSeq", "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" }, { "database": "PubMed", "id": "33785425", "url": "https://glygen.org/publication/PubMed/33785425" } ] }, { "annotation": "Impairment of spatial memory accuracy improved by Cbr1 copy number resumption and GABAB receptor-dependent enhancement of synaptic inhibition in Down syndrome model mice. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" }, { "database": "PubMed", "id": "32843708", "url": "https://glygen.org/publication/PubMed/32843708" } ] }, { "annotation": "NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol (By similarity). Can convert prostaglandin E to prostaglandin F2-alpha (By similarity). Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione. In addition, participates in the glucocorticoid metabolism by catalyzing the NADPH-dependent cortisol/corticosterone into 20beta-dihydrocortisol (20b-DHF) or 20beta-corticosterone (20b-DHB), which are weak agonists of NR3C1 and NR3C2 in adipose tissue (PubMed:28878267, PubMed:33785425).", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758#function" }, { "database": "UniProtKB", "id": "P16152", "url": "https://www.uniprot.org/uniprot/P16152#function" }, { "database": "PubMed", "id": "28878267", "url": "https://glygen.org/publication/PubMed/28878267" }, { "database": "PubMed", "id": "33785425", "url": "https://glygen.org/publication/PubMed/33785425" }, { "database": "UniProtKB", "id": "Q28960", "url": "https://www.uniprot.org/uniprot/Q28960#function" } ] }, { "annotation": "These findings suggest that CBR1 generating 20beta-dihydrocortisol is a novel pathway modulating GR activation and providing enzymatic protection against excessive GR activation in obesity. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" }, { "database": "PubMed", "id": "28878267", "url": "https://glygen.org/publication/PubMed/28878267" } ] } ], "disease": [ { "disease_id": "DOID:784", "recommended_name": { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic kidney disease", "description": "A kidney failure that is characterized by the gradual loss of kidney function." }, "synonyms": [ { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "CKD", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "CRF", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic kidney failure", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic renal disease", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic renal failure syndrome", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "renal failure - chronic", "description": "" } ], "evidence": [ { "id": "784", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:784" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cbr1", "url": "https://www.uniprot.org/uniprot/P48758", "locus": { "chromosome": "16", "start_pos": 93407393, "end_pos": 93402741, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000051483", "url": "https://www.ensembl.org/id/ENSMUSG00000051483" } ] } } ], "crossref": [ { "id": "ENSMUSG00000051483", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000051483", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.1.1.184", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.184&UniProtAcc=P48758", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd05324", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05324", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "12408", "url": "https://www.ncbi.nlm.nih.gov/gene/12408", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020904", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020904", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045313", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045313", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:12408", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12408", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "88284", "url": "http://www.informatics.jax.org/marker/MGI:88284", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P48758", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P48758", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "LALQYPK", "url": "https://omabrowser.org/oma/group/LALQYPK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3346557at2759", "url": "http://www.orthodb.org/?query=3346557at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43963", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43963", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43963:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43963:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00106", "url": "http://pfam.xfam.org/family/PF00106", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P48758", "url": "http://purl.obolibrary.org/obo/PR_P48758", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-2162123", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2162123", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "11636", "url": "https://www.rhea-db.org/rhea/11636", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "15937", "url": "https://www.rhea-db.org/rhea/15937", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "19257", "url": "https://www.rhea-db.org/rhea/19257", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "20744", "url": "https://www.rhea-db.org/rhea/20744", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "24508", "url": "https://www.rhea-db.org/rhea/24508", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63476", "url": "https://www.rhea-db.org/rhea/63476", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63480", "url": "https://www.rhea-db.org/rhea/63480", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63492", "url": "https://www.rhea-db.org/rhea/63492", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63500", "url": "https://www.rhea-db.org/rhea/63500", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63504", "url": "https://www.rhea-db.org/rhea/63504", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "70215", "url": "https://www.rhea-db.org/rhea/70215", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "70219", "url": "https://www.rhea-db.org/rhea/70219", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A338P684", "url": "https://www.uniprot.org/uniprot/A0A338P684", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A338P684-1", "url": "https://www.uniprot.org/uniprot/A0A338P684-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P48758-1", "url": "https://www.uniprot.org/uniprot/P48758-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGLSPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFKVNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQGRVVNVSSMVSLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPNSAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVQDKKVEPW", "length": 277, "header": "sp|P48758-1|CBR1_MOUSE Isoform 1 of Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3 CANONICAL=P48758-1" }, "isoforms": [ { "isoform_ac": "A0A338P684-1", "url": "", "sequence": { "sequence": "MSSSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGLSPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFKVNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQEW", "length": 134, "header": "tr|A0A338P684-1|A0A338P684_MOUSE Computationally mapped isoform of Carbonyl reductase 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=1 CANONICAL=P48758-1" }, "locus": { "chromosome": "16", "start_pos": 93406691, "end_pos": 93404854, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000231762.2", "url": "https://www.ensembl.org/id/ENSMUST00000231762.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000155872.2", "url": "https://www.ensembl.org/id/ENSMUSP00000155872.2" } ] } }, { "isoform_ac": "P48758-1", "url": "", "sequence": { "sequence": "MSSSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGLSPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFKVNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQGRVVNVSSMVSLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPNSAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVQDKKVEPW", "length": 277, "header": "sp|P48758-1|CBR1_MOUSE Isoform 1 of Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3 CANONICAL=P48758-1" }, "locus": { "chromosome": "16", "start_pos": 93407116, "end_pos": 93404854, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000039659", "url": "https://www.ensembl.org/id/ENSMUST00000039659" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000049394", "url": "https://www.ensembl.org/id/ENSMUSP00000049394" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P48758", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P48758" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" } ] } ], "phosphorylation": [ { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "site_lbl": "Ser2" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "P48758", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48758" } ], "site_lbl": "Ser30" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" }, { "database": "iPTMnet", "id": "P48758", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48758" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Carbonyl reductase 1 is an essential regulator of skeletal muscle differentiation and regeneration.", "journal": "The international journal of biochemistry & cell biology", "date": "2013", "authors": "Lim S, Shin JY, Jo A, Jyothi KR, Nguyen MN, Choi TG, Kim J, Park JH, Eun YG, Yoon KS, Ha J, Kim SS", "evidence": [ { "database": "RefSeq", "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" } ], "reference": [ { "type": "PubMed", "id": "23732109", "url": "https://glygen.org/publication/PubMed/23732109" } ] }, { "title": "Carbonyl reductase 1 catalyzes 20beta-reduction of glucocorticoids, modulating receptor activation and metabolic complications of obesity.", "journal": "Sci. Rep.", "date": "2017", "authors": "Morgan RA, Beck KR, Nixon M, Homer NZM, Crawford AA, Melchers D, Houtman R, Meijer OC, Stomby A, Anderson AJ, Upreti R, Stimson RH, Olsson T, Michoel T, Cohain A, Ruusalepp A, Schadt EE, Bjorkegren JLM, Andrew R, Kenyon CJ, Hadoke PWF, Odermatt A, Keen JA, Walker BR", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" }, { "database": "RefSeq", "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" } ], "reference": [ { "type": "PubMed", "id": "28878267", "url": "https://glygen.org/publication/PubMed/28878267" } ] }, { "title": "Carbonyl Reductase 1 Plays a Significant Role in Converting Doxorubicin to Cardiotoxic Doxorubicinol in Mouse Liver, but the Majority of the Doxorubicinol-Forming Activity Remains Unidentified.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2020", "authors": "Breysse DH, Boone RM, Long CM, Merrill ME, Schaupp CM, White CC, Kavanagh TJ, Schmidt EE, Merrill GF", "evidence": [ { "database": "RefSeq", "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" } ], "reference": [ { "type": "PubMed", "id": "31955137", "url": "https://glygen.org/publication/PubMed/31955137" } ] }, { "title": "Impairment of spatial memory accuracy improved by Cbr1 copy number resumption and GABAB receptor-dependent enhancement of synaptic inhibition in Down syndrome model mice.", "journal": "Scientific reports", "date": "2020", "authors": "Arima-Yoshida F, Raveau M, Shimohata A, Amano K, Fukushima A, Watanave M, Kobayashi S, Hattori S, Usui M, Sago H, Mataga N, Miyakawa T, Yamakawa K, Manabe T", "evidence": [ { "database": "RefSeq", "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" } ], "reference": [ { "type": "PubMed", "id": "32843708", "url": "https://glygen.org/publication/PubMed/32843708" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "P48758", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P48758" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "Carbonyl reductase 1 amplifies glucocorticoid action in adipose tissue and impairs glucose tolerance in lean mice.", "journal": "Mol. Metab.", "date": "2021", "authors": "Bell RMB, Villalobos E, Nixon M, Miguelez-Crespo A, Murphy L, Fawkes A, Coutts A, Sharp MGF, Koerner MV, Allan E, Meijer OC, Houtman R, Odermatt A, Beck KR, Denham SG, Lee P, Homer NZM, Walker BR, Morgan RA", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" }, { "database": "RefSeq", "id": "NP_031646", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031646" } ], "reference": [ { "type": "PubMed", "id": "33785425", "url": "https://glygen.org/publication/PubMed/33785425" } ] }, { "title": "Cloning a cDNA for carbonyl reductase (Cbr) from mouse cerebellum: murine genes that express cbr map to chromosomes 16 and 11.", "journal": "Genomics", "date": "1996", "authors": "Wei J, Dlouhy SR, Hara A, Ghetti B, Hodes ME", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "reference": [ { "type": "PubMed", "id": "8661038", "url": "https://glygen.org/publication/PubMed/8661038" } ] } ], "pathway": [ { "id": "mmu:12408", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12408", "resource": "KEGG Pathway" }, { "id": "R-MMU-2162123", "name": "Synthesis of Prostaglandins (PG) and Thromboxanes (TX)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2162123", "resource": "Reactome", "description": "Synthesis of Prostaglandins (PG) and Thromboxanes (TX)" } ], "orthologs": [ { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW", "length": 277 }, "evidence": [ { "id": "45225794", "url": "http://www.informatics.jax.org/homology/45225794", "database": "MGI" }, { "id": "P48758", "url": "https://omabrowser.org/oma/group/P48758/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P47727-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "Cbr1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSSDRPVALVTGANKGIGFAIVRDLCRKFLGDVVLTARDESRGHEAVKQLQTEGLSPRFHQLDIDNPQSIRALRDFLLQEYGGLNVLVNNAGIAFKVVDPTPFHIQAEVTMKTNFFGTQDVCKELLPIIKPQGRVVNVSSSVSLRALKSCSPELQQKFRSETITEEELVGLMNKFIEDAKKGVHAKEGWPNSAYGVTKIGVTVLSRIYARKLNEERREDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPGAEGPHGQFVQDKKVEPW", "length": 277 }, "evidence": [ { "id": "45225794", "url": "http://www.informatics.jax.org/homology/45225794", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "microvillus", "id": "GO:0005902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005902", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "subapical complex", "id": "GO:0035003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035003", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "positive regulation of reactive oxygen species metabolic process", "id": "GO:2000379", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000379", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "glucocorticoid metabolic process", "id": "GO:0008211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008211", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "vitamin K metabolic process", "id": "GO:0042373", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042373", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "alcohol dehydrogenase (NADP+) activity", "id": "GO:0008106", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008106", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor", "id": "GO:0016616", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016616", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor", "id": "GO:0016655", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016655", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity", "id": "GO:0047020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047020", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "carbonyl reductase (NADPH) activity", "id": "GO:0004090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004090", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "15-hydroxyprostaglandin dehydrogenase (NADP+) activity", "id": "GO:0047021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047021", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" }, { "name": "prostaglandin-E2 9-reductase activity", "id": "GO:0050221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050221", "evidence": [ { "database": "UniProtKB", "id": "P48758", "url": "https://www.uniprot.org/uniprot/P48758" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 137, "end_pos": 139, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "11636", "name": "", "equation": "NADP(+) + prostaglandin E1 = 15-oxoprostaglandin E1 + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "P16152-1", "P48758-1" ], "evidence": [ { "id": "11636", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/11636" } ] }, { "id": "15937", "name": "", "equation": "a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P51635-1", "P47727-1", "P14550-1", "P16152-1", "Q9JII6-1", "P48758-1", "P25377-1", "Q04894-1" ], "evidence": [ { "id": "15937", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/15937" } ] }, { "id": "19257", "name": "", "equation": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "Q8VID1-1", "B2GV72-1", "O75828-1", "P16152-1", "Q9BTZ2-1", "A0A1B0GRG8-1", "Q8K354-1", "P48758-1", "P08074-1", "Q99LB2-1" ], "evidence": [ { "id": "19257", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19257" } ] }, { "id": "20744", "name": "", "equation": "NADP(+) + prostaglandin D2 = 15-oxoprostaglandin D2 + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "P16152-1", "P48758-1" ], "evidence": [ { "id": "20744", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/20744" } ] }, { "id": "24508", "name": "", "equation": "NADP(+) + prostaglandin F2alpha = H(+) + NADPH + prostaglandin E2", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "P16152-1", "P48758-1" ], "evidence": [ { "id": "24508", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/24508" } ] }, { "id": "63476", "name": "", "equation": "NADP(+) + prostaglandin E2 = 15-oxoprostaglandin E2 + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "P16152-1", "P48758-1" ], "evidence": [ { "id": "63476", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63476" } ] }, { "id": "63480", "name": "", "equation": "NADP(+) + prostaglandin F2alpha = 15-oxoprostaglandin F2alpha + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "P16152-1", "P48758-1" ], "evidence": [ { "id": "63480", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63480" } ] }, { "id": "63492", "name": "", "equation": "H(+) + menadione + NADPH = menadiol + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "P16152-1", "P48758-1" ], "evidence": [ { "id": "63492", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63492" } ] }, { "id": "63500", "name": "", "equation": "H(+) + NADPH + S-nitrosoglutathione = NADP(+) + sulfinamide glutathione", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "P16152-1", "P48758-1" ], "evidence": [ { "id": "63500", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63500" } ] }, { "id": "63504", "name": "", "equation": "daunorubicin + H(+) + NADPH = 13-dihydrodaunorubicin + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "P16152-1", "P48758-1" ], "evidence": [ { "id": "63504", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63504" } ] }, { "id": "70215", "name": "", "equation": "cortisol + H(+) + NADPH = 20beta-dihydrocortisol + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "P16152-1", "P48758-1" ], "evidence": [ { "id": "70215", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70215" } ] }, { "id": "70219", "name": "", "equation": "corticosterone + H(+) + NADPH = 20beta-dihydrocorticosterone + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "P16152-1", "P48758-1" ], "evidence": [ { "id": "70219", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70219" } ] }, { "id": "R-MMU-2161651", "name": "PGE2 is converted to PGF2a by CBR1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-265287" ], "output_participant_list": [], "enzyme_list": [ "P48758-1" ], "evidence": [ { "id": "R-MMU-2161651", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2161651" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-265287", "participant_name": "PGE2 [cytosol]", "crossref": [ { "id": "HMDB0001220", "database": "HMDB Metabolite", "url": "" }, { "id": "000003830713", "database": "ZINC", "url": "" }, { "id": "C00584", "database": "COMPOUND", "url": "" }, { "id": "15551", "database": "ChEBI", "url": "" }, { "id": "15551", "database": "ChEBI", "url": "" }, { "id": "HMDB0001220", "database": "HMDB Metabolite", "url": "" }, { "id": "C00584", "database": "COMPOUND", "url": "" }, { "id": "000003830713", "database": "ZINC", "url": "" }, { "id": "15551", "database": "ChEBI", "url": "" }, { "id": "HMDB0001220", "database": "HMDB Metabolite", "url": "" }, { "id": "C00584", "database": "COMPOUND", "url": "" }, { "id": "000003830713", "database": "ZINC", "url": "" }, { "id": "000003830713", "database": "ZINC", "url": "" }, { "id": "HMDB0001220", "database": "HMDB Metabolite", "url": "" }, { "id": "15551", "database": "ChEBI", "url": "" }, { "id": "C00584", "database": "COMPOUND", "url": "" }, { "id": "HMDB0001220", "database": "HMDB Metabolite", "url": "" }, { "id": "000003830713", "database": "ZINC", "url": "" }, { "id": "C00584", "database": "COMPOUND", "url": "" }, { "id": "15551", "database": "ChEBI", "url": "" }, { "id": "000003830713", "database": "ZINC", "url": "" }, { "id": "HMDB0001220", "database": "HMDB Metabolite", "url": "" }, { "id": "15551", "database": "ChEBI", "url": "" }, { "id": "C00584", "database": "COMPOUND", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A1B0GRG8", "gene_name": "Gm5678", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "A0A1B0GRG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GRG8" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "A0A1B0GRG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GRG8" } ] } ] }, { "uniprot_ac": "B2GV72", "gene_name": "Cbr3", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "B2GV72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV72" } ] }, { "ec_number": "1.6.5.10", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "B2GV72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV72" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "B2GV72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV72" } ] } ] }, { "uniprot_ac": "O75828", "gene_name": "CBR3", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "O75828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75828" } ] }, { "ec_number": "1.6.5.10", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "O75828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75828" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "O75828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75828" } ] } ] }, { "uniprot_ac": "P08074", "gene_name": "Cbr2", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P08074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08074" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "P08074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08074" } ] } ] }, { "uniprot_ac": "P14550", "gene_name": "AKR1A1", "activity": [ { "ec_number": "1.1.1.2", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.19", "activity": "L-gulonate + NADP(+) = aldehydo-D-glucuronate + H(+) + NADPH.", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.20", "activity": "L-gulono-1,4-lactone + NADP(+) = D-glucurono-3,6-lactone + H(+) + NADPH.", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.2", "activity": "", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] } ] }, { "uniprot_ac": "P16152", "gene_name": "CBR1", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] }, { "ec_number": "1.1.1.189", "activity": "NADP(+) + prostaglandin F2alpha = H(+) + NADPH + prostaglandin E2.", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] }, { "ec_number": "1.1.1.197", "activity": "NADP(+) + prostaglandin E1 = 15-oxoprostaglandin E1 + H(+) + NADPH.", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] }, { "ec_number": "1.1.1.196", "activity": "NADP(+) + prostaglandin D2 = 15-oxoprostaglandin D2 + H(+) + NADPH.", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] }, { "ec_number": "1.1.1.71", "activity": "a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH.", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] } ] }, { "uniprot_ac": "P25377", "gene_name": "ADH7", "activity": [ { "ec_number": "1.1.1.2", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P25377", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25377" } ] }, { "ec_number": "1.1.1.2", "activity": "", "evidence": [ { "id": "P25377", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25377" } ] } ] }, { "uniprot_ac": "P47727", "gene_name": "Cbr1", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] }, { "ec_number": "1.1.1.189", "activity": "NADP(+) + prostaglandin F2alpha = H(+) + NADPH + prostaglandin E2.", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] }, { "ec_number": "1.1.1.197", "activity": "NADP(+) + prostaglandin E1 = 15-oxoprostaglandin E1 + H(+) + NADPH.", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] }, { "ec_number": "1.1.1.196", "activity": "NADP(+) + prostaglandin D2 = 15-oxoprostaglandin D2 + H(+) + NADPH.", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] }, { "ec_number": "1.1.1.71", "activity": "a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH.", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] } ] }, { "uniprot_ac": "P48758", "gene_name": "Cbr1", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] }, { "ec_number": "1.1.1.189", "activity": "NADP(+) + prostaglandin F2alpha = H(+) + NADPH + prostaglandin E2.", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] }, { "ec_number": "1.1.1.197", "activity": "NADP(+) + prostaglandin E1 = 15-oxoprostaglandin E1 + H(+) + NADPH.", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] }, { "ec_number": "1.1.1.196", "activity": "NADP(+) + prostaglandin D2 = 15-oxoprostaglandin D2 + H(+) + NADPH.", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] }, { "ec_number": "1.1.1.71", "activity": "a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH.", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] } ] }, { "uniprot_ac": "P51635", "gene_name": "Akr1a1", "activity": [ { "ec_number": "1.1.1.2", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.19", "activity": "L-gulonate + NADP(+) = aldehydo-D-glucuronate + H(+) + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.20", "activity": "L-gulono-1,4-lactone + NADP(+) = D-glucurono-3,6-lactone + H(+) + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.19", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.20", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.2", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.33", "activity": "(R)-mevalonate + NADP(+) = H(+) + mevaldate + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.33", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] } ] }, { "uniprot_ac": "Q04894", "gene_name": "ADH6", "activity": [ { "ec_number": "1.1.1.2", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q04894", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04894" } ] }, { "ec_number": "1.1.1.2", "activity": "", "evidence": [ { "id": "Q04894", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04894" } ] } ] }, { "uniprot_ac": "Q8K354", "gene_name": "Cbr3", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q8K354", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K354" } ] }, { "ec_number": "1.6.5.10", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "Q8K354", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K354" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q8K354", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K354" } ] } ] }, { "uniprot_ac": "Q8VID1", "gene_name": "Dhrs4", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] } ] }, { "uniprot_ac": "Q99LB2", "gene_name": "Dhrs4", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] } ] }, { "uniprot_ac": "Q9BTZ2", "gene_name": "DHRS4", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q9BTZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BTZ2" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q9BTZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BTZ2" } ] } ] }, { "uniprot_ac": "Q9JII6", "gene_name": "Akr1a1", "activity": [ { "ec_number": "1.1.1.2", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.19", "activity": "L-gulonate + NADP(+) = aldehydo-D-glucuronate + H(+) + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.20", "activity": "L-gulono-1,4-lactone + NADP(+) = D-glucurono-3,6-lactone + H(+) + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.33", "activity": "(R)-mevalonate + NADP(+) = H(+) + mevaldate + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.33", "activity": "", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.2", "activity": "", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }