{ "uniprot_canonical_ac": "P48565-1", "uniprot_ac": "P48565", "uniprot_id": "PALH_YEAST", "mass": { "chemical_mass": 61532.0, "monoisotopic_mass": 61532.0 }, "refseq": { "ac": "NP_014105", "name": "Rim21p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014105" }, "gene_names": [ { "name": "RIM21", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P48565", "id": "P48565" }, { "name": "N0466", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P48565", "id": "P48565" }, { "name": "PAL2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014105", "id": "NP_014105" }, { "name": "PAL2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P48565", "id": "P48565" }, { "name": "RIM21", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014105", "id": "NP_014105" } ], "protein_names": [ { "name": "pH-response regulator protein palH/RIM21", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P48565" }, { "name": "Regulator of IME2 protein 21", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P48565" }, { "name": "Rim21p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014105", "id": "NP_014105" } ], "function": [ { "annotation": "Required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH (By similarity). Required for growth at alkaline pH.", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565#function" }, { "database": "PubMed", "id": "10821185", "url": "https://glygen.org/publication/PubMed/10821185" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "common_name": "Yeast" } ], "gene": [ { "name": "RIM21", "url": "https://www.uniprot.org/uniprot/P48565", "locus": { "chromosome": "XIV", "start_pos": 78659, "end_pos": 80260, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "YNL294C", "url": "https://www.ensembl.org/id/YNL294C" } ] } } ], "crossref": [ { "id": "855422", "url": "https://www.ncbi.nlm.nih.gov/gene/855422", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR014844", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014844", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YNL294C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL294C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CVVIPWE", "url": "https://omabrowser.org/oma/group/CVVIPWE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1989700at2759", "url": "http://www.orthodb.org/?query=1989700at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR35779", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35779", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR35779:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35779:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08733", "url": "http://pfam.xfam.org/family/PF08733", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P48565", "url": "http://purl.obolibrary.org/obo/PR_P48565", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014105", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014105", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005238", "url": "https://www.yeastgenome.org/locus/S000005238", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P48565-1", "url": "https://www.uniprot.org/uniprot/P48565-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNLWRHSPEELAAYNSCHPMKLGSGVLIQLPLYDNSAVYAEDITFRSFCCERVPVYVSTVLRNSSPYRYLDEVINDWQKFIQVSDYVGGSAEYAIYAVILSITSNFVITVFLTVICCINISGRAYKRILQLLRIASLLASLNLTIFITKVLRRLEKEHNVYGVVRAHSIMHIFSDDMTFVVLDFLATLMFQFCQVGIVIRLFQRAQEKRIIFFIGVILTITANILWVIPPFANHTTKHRNDWQILRPFVYLFRIAIATSYASIVIYHIWQKKKLWFKFNQMGLLTLLTILVVLLLPGFFLADVSNLWISELGEVFNTTCYVTSTVITWEWLDRLNVLERKEEAQSILGRPIFEEEQQDYRFAKYALRVQNALTRRESQDASTDRHDTSSNSEVCDLQTISRYDPEDQISVGRSIDRMHFNDRGTYKDVALKKLGYARDKILYFTDQIVQKSVGHNNSSSSKNEKTKQRKAMVRKRLGLDKPGIYIYSTKDVVFNSDEDDDENAEDEDDDEYEVGSEGNNNSSATFTSDHIGHI", "length": 533, "header": "sp|P48565-1|PALH_YEAST Isoform 1 of pH-response regulator protein palH/RIM21 OS=Saccharomyces cerevisiae S288C OX=559292 GN=RIM21 PE=1 SV=1 CANONICAL=P48565-1" }, "isoforms": [ { "isoform_ac": "P48565-1", "url": "", "sequence": { "sequence": "MNLWRHSPEELAAYNSCHPMKLGSGVLIQLPLYDNSAVYAEDITFRSFCCERVPVYVSTVLRNSSPYRYLDEVINDWQKFIQVSDYVGGSAEYAIYAVILSITSNFVITVFLTVICCINISGRAYKRILQLLRIASLLASLNLTIFITKVLRRLEKEHNVYGVVRAHSIMHIFSDDMTFVVLDFLATLMFQFCQVGIVIRLFQRAQEKRIIFFIGVILTITANILWVIPPFANHTTKHRNDWQILRPFVYLFRIAIATSYASIVIYHIWQKKKLWFKFNQMGLLTLLTILVVLLLPGFFLADVSNLWISELGEVFNTTCYVTSTVITWEWLDRLNVLERKEEAQSILGRPIFEEEQQDYRFAKYALRVQNALTRRESQDASTDRHDTSSNSEVCDLQTISRYDPEDQISVGRSIDRMHFNDRGTYKDVALKKLGYARDKILYFTDQIVQKSVGHNNSSSSKNEKTKQRKAMVRKRLGLDKPGIYIYSTKDVVFNSDEDDDENAEDEDDDEYEVGSEGNNNSSATFTSDHIGHI", "length": 533, "header": "sp|P48565-1|PALH_YEAST Isoform 1 of pH-response regulator protein palH/RIM21 OS=Saccharomyces cerevisiae S288C OX=559292 GN=RIM21 PE=1 SV=1 CANONICAL=P48565-1" }, "locus": { "chromosome": "XIV", "start_pos": 80260, "end_pos": 78662, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YNL294C_mRNA", "url": "https://www.ensembl.org/id/YNL294C_mRNA" }, { "database": "Ensembl Peptide", "id": "YNL294C", "url": "https://www.ensembl.org/id/YNL294C" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "iPTMnet", "id": "P48565", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48565" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P48565", "url": "https://www.yeastgenome.org/locus/P48565" } ], "site_lbl": "Ser409" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Ambient pH signalling in ascomycetous yeasts involves homologues of the Aspergillus nidulans genes palF and palH.", "journal": "Mol. Gen. Genet.", "date": "2000", "authors": "Lambert M., Gaillardin C., Blanchin-Roland S., Lepingle A., Treton B.", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "reference": [ { "type": "PubMed", "id": "10821185", "url": "https://glygen.org/publication/PubMed/10821185" } ] }, { "title": "A global topology map of the Saccharomyces cerevisiae membrane proteome.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Kim H., von Heijne G., Melen K., Oesterberg M.", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "reference": [ { "type": "PubMed", "id": "16847258", "url": "https://glygen.org/publication/PubMed/16847258" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" }, { "database": "iPTMnet", "id": "P48565", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48565" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "iPTMnet", "id": "P48565", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48565" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Sequence analysis of a 30 kb DNA segment from yeast chromosome XIV carrying a ribosomal protein gene cluster, the genes encoding a plasma membrane protein and a subunit of replication factor C, and a novel putative serine/threonine protein kinase gene.", "journal": "Yeast", "date": "1995", "authors": "Planta R.J., Maurer K.C.T., Urbanus J.H.M.", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "reference": [ { "type": "PubMed", "id": "8553702", "url": "https://glygen.org/publication/PubMed/8553702" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.", "journal": "Nature", "date": "1997", "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "reference": [ { "type": "PubMed", "id": "9169873", "url": "https://glygen.org/publication/PubMed/9169873" } ] } ], "pathway": [ { "id": "sce:YNL294C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL294C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "cellular response to alkaline pH", "id": "GO:0071469", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071469", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "pmid": "" }, { "name": "cellular response to pH", "id": "GO:0071467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071467", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "pmid": "" }, { "name": "regulation of vacuole organization", "id": "GO:0044088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044088", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "pmid": "" }, { "name": "invasive growth in response to glucose limitation", "id": "GO:0001403", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001403", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "pmid": "" }, { "name": "fungal-type cell wall biogenesis", "id": "GO:0009272", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009272", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "pmid": "" }, { "name": "ascospore formation", "id": "GO:0030437", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030437", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P48565", "url": "https://www.uniprot.org/uniprot/P48565" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 119, "end_pos": 121, "annotation": "n_glycosylation_sequon" }, { "start_pos": 142, "end_pos": 144, "annotation": "n_glycosylation_sequon" }, { "start_pos": 233, "end_pos": 235, "annotation": "n_glycosylation_sequon" }, { "start_pos": 316, "end_pos": 318, "annotation": "n_glycosylation_sequon" }, { "start_pos": 455, "end_pos": 457, "annotation": "n_glycosylation_sequon" }, { "start_pos": 456, "end_pos": 458, "annotation": "n_glycosylation_sequon" }, { "start_pos": 519, "end_pos": 521, "annotation": "n_glycosylation_sequon" }, { "start_pos": 520, "end_pos": 522, "annotation": "n_glycosylation_sequon" }, { "start_pos": 63, "end_pos": 65, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }