{
    "uniprot_canonical_ac": "P48164-1",
    "uniprot_ac": "P48164",
    "uniprot_id": "RS7B_YEAST",
    "mass": {
        "chemical_mass": 21634.0,
        "monoisotopic_mass": 21634.0
    },
    "refseq": {
        "ac": "NP_014303",
        "name": "ribosomal 40S subunit protein S7B",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014303"
    },
    "gene_names": [
        {
            "name": "RPS7B",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P48164",
            "id": "P48164"
        },
        {
            "name": "N2212",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P48164",
            "id": "P48164"
        },
        {
            "name": "RPS7B",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014303",
            "id": "NP_014303"
        }
    ],
    "protein_names": [
        {
            "name": "Small ribosomal subunit protein eS7B",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P48164"
        },
        {
            "name": "40S ribosomal protein S7-B",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P48164"
        },
        {
            "name": "ribosomal 40S subunit protein S7B",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014303",
            "id": "NP_014303"
        }
    ],
    "function": [
        {
            "annotation": "Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel (PubMed:22096102). eS7 is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly (PubMed:15590835).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164#function"
                },
                {
                    "database": "PubMed",
                    "id": "15590835",
                    "url": "https://glygen.org/publication/PubMed/15590835"
                },
                {
                    "database": "PubMed",
                    "id": "22096102",
                    "url": "https://glygen.org/publication/PubMed/22096102"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0111881",
            "recommended_name": {
                "id": "DOID:0111881",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0111881",
                "name": "Diamond-Blackfan anemia 8",
                "description": "A Diamond-Blackfan anemia that has_material_basis_in heterozygous mutation in the RPS7 gene on chromosome 2p25.3."
            },
            "synonyms": [
                {
                    "id": "DOID:0111881",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111881",
                    "name": "DBA8",
                    "description": ""
                },
                {
                    "id": "DOID:0111881",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111881",
                    "name": "RPS7-related Diamond-Blackfan anemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0012939",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012939",
                    "name": "Diamond-Blackfan anemia 8",
                    "description": "Any Diamond-Blackfan anemia in which the cause of the disease is a mutation in the RPS7 gene."
                },
                {
                    "id": "MONDO:0012939",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012939",
                    "name": "Diamond-Blackfan Anaemia type 8",
                    "description": ""
                },
                {
                    "id": "MONDO:0012939",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012939",
                    "name": "Diamond-Blackfan Anemia type 8",
                    "description": ""
                },
                {
                    "id": "MONDO:0012939",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012939",
                    "name": "Diamond-Blackfan anaemia caused by mutation in RPS7",
                    "description": ""
                },
                {
                    "id": "MONDO:0012939",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012939",
                    "name": "Diamond-Blackfan anemia 8",
                    "description": ""
                },
                {
                    "id": "MONDO:0012939",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012939",
                    "name": "Diamond-Blackfan anemia caused by mutation in RPS7",
                    "description": ""
                },
                {
                    "id": "MONDO:0012939",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012939",
                    "name": "RPS7 Diamond-Blackfan anaemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0012939",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012939",
                    "name": "RPS7 Diamond-Blackfan anemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0012939",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012939",
                    "name": "DBA8",
                    "description": ""
                },
                {
                    "id": "MIM:612563",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/612563",
                    "name": "Diamond-Blackfan anemia 8",
                    "description": "Diamond-Blackfan anemia 8"
                }
            ],
            "evidence": [
                {
                    "id": "0111881",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0111881"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "RPS7B",
            "url": "https://www.uniprot.org/uniprot/P48164",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "855628",
            "url": "https://www.ncbi.nlm.nih.gov/gene/855628",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "P48164",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P48164*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR000554",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000554",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YNL096C",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL096C",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "HTKKVGQ",
            "url": "https://omabrowser.org/oma/group/HTKKVGQ/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5473994at2759",
            "url": "http://www.orthodb.org/?query=5473994at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11278",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11278",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11278:SF0",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11278:SF0",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF01251",
            "url": "http://pfam.xfam.org/family/PF01251",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P48164",
            "url": "http://purl.obolibrary.org/obo/PR_P48164",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_014303",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014303",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000005040",
            "url": "https://www.yeastgenome.org/locus/S000005040",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P48164",
            "url": "https://www.uniprot.org/uniprot/P48164",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P48164-1",
            "url": "https://www.uniprot.org/uniprot/P48164-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSSVQSKILSQAPSELELQVAKTFIDLESSSPELKADLRPLQIKSIREIDVTGGKKALVLFVPVPALSAYHKVQTKLTRELEKKFPDRHVIFLAERRILPKPSRTSRQVQKRPRSRTLTAVHDKVLEDMVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQQIDYKLESFQAVYNKLTGKQIVFEIPSQTN",
        "length": 190,
        "header": "sp|P48164-1|RS7B_YEAST Isoform 1 of Small ribosomal subunit protein eS7B  OS=Saccharomyces cerevisiae S288C OX=559292 GN=RPS7B PE=1 SV=1 CANONICAL=P48164-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P48164-1",
            "url": "",
            "sequence": {
                "sequence": "MSSVQSKILSQAPSELELQVAKTFIDLESSSPELKADLRPLQIKSIREIDVTGGKKALVLFVPVPALSAYHKVQTKLTRELEKKFPDRHVIFLAERRILPKPSRTSRQVQKRPRSRTLTAVHDKVLEDMVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQQIDYKLESFQAVYNKLTGKQIVFEIPSQTN",
                "length": 190,
                "header": "sp|P48164-1|RS7B_YEAST Isoform 1 of Small ribosomal subunit protein eS7B  OS=Saccharomyces cerevisiae S288C OX=559292 GN=RPS7B PE=1 SV=1 CANONICAL=P48164-1"
            },
            "locus": {
                "chromosome": "XIV",
                "start_pos": 444315,
                "end_pos": 443401,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YNL096C_mRNA",
                        "url": "https://www.ensembl.org/id/YNL096C_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YNL096C",
                        "url": "https://www.ensembl.org/id/YNL096C"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 10,
            "end_pos": 10,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                },
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                },
                {
                    "database": "SGD",
                    "id": "P48164",
                    "url": "https://www.yeastgenome.org/locus/P48164"
                }
            ],
            "site_lbl": "Ser10"
        },
        {
            "start_pos": 115,
            "end_pos": 115,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "17287358",
                    "url": "https://glygen.org/publication/PubMed/17287358"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "PubMed",
                    "id": "20702584",
                    "url": "https://glygen.org/publication/PubMed/20702584"
                },
                {
                    "database": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                },
                {
                    "database": "SGD",
                    "id": "P48164",
                    "url": "https://www.yeastgenome.org/locus/P48164"
                }
            ],
            "site_lbl": "Ser115"
        },
        {
            "start_pos": 117,
            "end_pos": 117,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "17287358",
                    "url": "https://glygen.org/publication/PubMed/17287358"
                },
                {
                    "database": "PubMed",
                    "id": "20702584",
                    "url": "https://glygen.org/publication/PubMed/20702584"
                },
                {
                    "database": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                },
                {
                    "database": "SGD",
                    "id": "P48164",
                    "url": "https://www.yeastgenome.org/locus/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Thr117"
        },
        {
            "start_pos": 119,
            "end_pos": 119,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                },
                {
                    "database": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                },
                {
                    "database": "SGD",
                    "id": "P48164",
                    "url": "https://www.yeastgenome.org/locus/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Thr119"
        },
        {
            "start_pos": 14,
            "end_pos": 14,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                },
                {
                    "database": "SGD",
                    "id": "P48164",
                    "url": "https://www.yeastgenome.org/locus/P48164"
                }
            ],
            "site_lbl": "Ser14"
        },
        {
            "start_pos": 156,
            "end_pos": 156,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "SGD",
                    "id": "P48164",
                    "url": "https://www.yeastgenome.org/locus/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Ser156"
        },
        {
            "start_pos": 23,
            "end_pos": 23,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ],
            "site_lbl": "Thr23"
        },
        {
            "start_pos": 31,
            "end_pos": 31,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                },
                {
                    "database": "PubMed",
                    "id": "17330950",
                    "url": "https://glygen.org/publication/PubMed/17330950"
                },
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "15665377",
                    "url": "https://glygen.org/publication/PubMed/15665377"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                },
                {
                    "database": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                },
                {
                    "database": "PubMed",
                    "id": "20702584",
                    "url": "https://glygen.org/publication/PubMed/20702584"
                },
                {
                    "database": "SGD",
                    "id": "P48164",
                    "url": "https://www.yeastgenome.org/locus/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Ser31"
        },
        {
            "start_pos": 75,
            "end_pos": 75,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "SGD",
                    "id": "P48164",
                    "url": "https://www.yeastgenome.org/locus/P48164"
                },
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Thr75"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The action of N-terminal acetyltransferases on yeast ribosomal proteins.",
            "journal": "J. Biol. Chem.",
            "date": "1999",
            "authors": "Arnold R J, Polevoda B, Reilly J P, Sherman F",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10601260",
                    "url": "https://glygen.org/publication/PubMed/10601260"
                }
            ]
        },
        {
            "title": "Global analysis of protein localization in budding yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562095",
                    "url": "https://glygen.org/publication/PubMed/14562095"
                }
            ]
        },
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "The small-subunit processome is a ribosome assembly intermediate.",
            "journal": "Eukaryot. Cell",
            "date": "2004",
            "authors": "Bernstein Kara A, Gallagher Jennifer E G, Mitchell Brianna M, Granneman Sander, Baserga Susan J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15590835",
                    "url": "https://glygen.org/publication/PubMed/15590835"
                }
            ]
        },
        {
            "title": "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2005-03",
            "authors": "Gruhler Albrecht, Olsen Jesper V, Mohammed Shabaz, Mortensen Peter, Faergeman Nils J, Mann Matthias, Jensen Ole N",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15665377",
                    "url": "https://glygen.org/publication/PubMed/15665377"
                }
            ]
        },
        {
            "title": "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2007-02-13",
            "authors": "Chi An, Huttenhower Curtis, Geer Lewis Y, Coon Joshua J, Syka John E P, Bai Dina L, Shabanowitz Jeffrey, Burke Daniel J, Troyanskaya Olga G, Hunt Donald F",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17287358",
                    "url": "https://glygen.org/publication/PubMed/17287358"
                }
            ]
        },
        {
            "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.",
            "journal": "Journal of proteome research",
            "date": "2007-03",
            "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                },
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17330950",
                    "url": "https://glygen.org/publication/PubMed/17330950"
                }
            ]
        },
        {
            "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2008-07",
            "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                },
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                }
            ]
        },
        {
            "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.",
            "journal": "Science (New York, N.Y.)",
            "date": "2009-09-25",
            "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                },
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                }
            ]
        },
        {
            "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.",
            "journal": "Proteomics",
            "date": "2009-10",
            "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                }
            ]
        },
        {
            "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.",
            "journal": "Molecular bioSystems",
            "date": "2009-11",
            "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                }
            ]
        },
        {
            "title": "The rapamycin-sensitive phosphoproteome reveals that TOR controls protein kinase A toward some but not all substrates.",
            "journal": "Molecular biology of the cell",
            "date": "2010-10-01",
            "authors": "Soulard Alexandre, Cremonesi Alessio, Moes Suzette, Sch\u00fctz Fr\u00e9d\u00e9ric, Jen\u00f6 Paul, Hall Michael N",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20702584",
                    "url": "https://glygen.org/publication/PubMed/20702584"
                }
            ]
        },
        {
            "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.",
            "journal": "BMC genomics",
            "date": "2010-12-02",
            "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ]
        },
        {
            "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.",
            "journal": "Science signaling",
            "date": "2010-12-21",
            "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                }
            ]
        },
        {
            "title": "The structure of the eukaryotic ribosome at 3.0 A resolution.",
            "journal": "Science",
            "date": "2011",
            "authors": "Jenner L., Yusupov M., Ben-Shem A., Garreau de Loubresse N., Melnikov S., Yusupova G.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22096102",
                    "url": "https://glygen.org/publication/PubMed/22096102"
                }
            ]
        },
        {
            "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.",
            "journal": "Nature methods",
            "date": "2013-07",
            "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P48164",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "A new system for naming ribosomal proteins.",
            "journal": "Curr. Opin. Struct. Biol.",
            "date": "2014",
            "authors": "Ban N., Ramakrishnan V., Dinman J.D., Liljas A., Ortega J., Steitz T.A., Wilson D., Dragon F., Beckmann R., Warren A.J., Tollervey D., Lipton J.M., Tchorzewski M., Cate J.H.D., Ellis S.R., Lafontaine D.L.J., Lindahl L., McAlear M.A., Moore P.B., Noller H.F., Panse V.G., Spahn C.M.T., Williamson J.R., Yonath A., Yusupov M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24524803",
                    "url": "https://glygen.org/publication/PubMed/24524803"
                }
            ]
        },
        {
            "title": "Sequence analysis of a 14.2 kb fragment of Saccharomyces cerevisiae chromosome XIV that includes the ypt53, tRNALeu and gsr m2 genes and four new open reading frames.",
            "journal": "Yeast",
            "date": "1996",
            "authors": "Jimenez A., Boskovic J., Garcia-Cantalejo J.M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8771715",
                    "url": "https://glygen.org/publication/PubMed/8771715"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Duesterhoeft A., Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Verhasselt P., Lanfranchi G., Valle G., Planta R.J., Jacquet M., Kleine K., Floeth M., Mallet L., Jimenez A., Dubois E., Volckaert G., Andre B., De Antoni A., Baladron V., Boskovic J., Nasr F., Pandolfo D., Philippsen P., Poehlmann R., Domdey H., D'Angelo M., Pohl T.M., Lyck R., Sartorello F., Ballesta J.P.G., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Fleig U., Gaillardin C., Glansdorff N., Goffeau A., Gueldener U., Hani J., Hegemann J.H., Herbert C.J., Messenguy F., Pierard A., Remacha M.A., Revuelta J.L., Scherens B., Vissers S., Wach A., Zollner A., del Rey F., Fiedler T.A., Jonniaux J.-L., Lepingle A., Niedenthal R.K., Purnelle B., Saiz J.E., Urrestarazu L.A., Vierendeels F., Voet M., Aert R., Albermann K., Altmann R., Beinhauer J.D., Buitrago M.J., Coster F., Dal Pero F., Fritz C., Garcia-Cantalejo J.M., Hamberg K., Heumann K., Heuss-Neitzel D., Hilbert H., Hinni K., Iraqui Houssaini I., Karpfinger-Hartl L., Levesque H., Maftahi M., Maurer C.T.C., Moestl D., Nicaud J.-M., Piravandi E., Rebischung C., Rinke M., Sen-Gupta M., Soler-Mira A., Urbanus J.H.M., Van Dyck L.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169873",
                    "url": "https://glygen.org/publication/PubMed/9169873"
                }
            ]
        },
        {
            "title": "The list of cytoplasmic ribosomal proteins of Saccharomyces cerevisiae.",
            "journal": "Yeast",
            "date": "1998",
            "authors": "Mager W.H., Planta R.J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9559554",
                    "url": "https://glygen.org/publication/PubMed/9559554"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YNL096C",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YNL096C",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 4,
                "go_terms": [
                    {
                        "name": "nucleolus",
                        "id": "GO:0005730",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P48164",
                                "url": "https://www.uniprot.org/uniprot/P48164"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytosol",
                        "id": "GO:0005829",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P48164",
                                "url": "https://www.uniprot.org/uniprot/P48164"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "small-subunit processome",
                        "id": "GO:0032040",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032040",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P48164",
                                "url": "https://www.uniprot.org/uniprot/P48164"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytosolic small ribosomal subunit",
                        "id": "GO:0022627",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022627",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P48164",
                                "url": "https://www.uniprot.org/uniprot/P48164"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 4,
                "go_terms": [
                    {
                        "name": "ribosome biogenesis",
                        "id": "GO:0042254",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042254",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P48164",
                                "url": "https://www.uniprot.org/uniprot/P48164"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "rRNA processing",
                        "id": "GO:0006364",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006364",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P48164",
                                "url": "https://www.uniprot.org/uniprot/P48164"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasmic translation",
                        "id": "GO:0002181",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002181",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P48164",
                                "url": "https://www.uniprot.org/uniprot/P48164"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ribosomal small subunit biogenesis",
                        "id": "GO:0042274",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042274",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P48164",
                                "url": "https://www.uniprot.org/uniprot/P48164"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "structural constituent of ribosome",
                        "id": "GO:0003735",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003735",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P48164",
                                "url": "https://www.uniprot.org/uniprot/P48164"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [
        {
            "annotation": "N-terminally acetylated by acetyltransferase NatA.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "10601260",
                    "url": "https://glygen.org/publication/PubMed/10601260"
                }
            ]
        },
        {
            "annotation": "Ubiquitinated at Lys-83 and Lys-84 in response to stalled ribosomes, leading to activation of the No-Go Decay (NGD) pathway: first monoubiquitinated by MOT2/NOT4, followed by formation by HEL2 of 'Lys-63'-linked polyubiquitin chains on monoubiquitin.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P48164",
                    "url": "https://www.uniprot.org/uniprot/P48164"
                },
                {
                    "database": "PubMed",
                    "id": "30609991",
                    "url": "https://glygen.org/publication/PubMed/30609991"
                }
            ]
        }
    ],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 9
                },
                {
                    "field": "total_sites",
                    "count": 9
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 21
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}