{ "uniprot_canonical_ac": "P47143-1", "uniprot_ac": "P47143", "uniprot_id": "ADK_YEAST", "mass": { "chemical_mass": 36372.0, "monoisotopic_mass": 36372.0 }, "refseq": { "ac": "NP_012639", "name": "adenosine kinase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012639" }, "gene_names": [ { "name": "ADO1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P47143", "id": "P47143" }, { "name": "ADO1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012639", "id": "NP_012639" }, { "name": "J1973", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P47143", "id": "P47143" } ], "protein_names": [ { "name": "Adenosine kinase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P47143" }, { "name": "2.7.1.20", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P47143" }, { "name": "adenosine kinase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012639", "id": "NP_012639" } ], "function": [ { "annotation": "ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives. ADO1 does not play a major role in adenine utilization in yeast. Its physiological role could primarily be to recycle adenosine produced by the methyl cycle.", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143#function" } ] } ], "disease": [ { "disease_id": "DOID:0111038", "recommended_name": { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "hypermethioninemia due to adenosine kinase deficiency", "description": "A hypermethioninemia characterized by autosomal recessive inheritance of developmental delay, early-onset seizures, mild dysmorphic features, and characteristic biochemical anomalies, including persistent hypermethioninemia that has_material_basis_in homozygous mutation in the ADK gene on chromosome 10q22." }, "synonyms": [ { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "hypermethioninemia encephalopathy due to ADK deficiency", "description": "" }, { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "ADK hypermethioninemia", "description": "" }, { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "MRT8", "description": "" }, { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "autosomal recessive mental retardation 8", "description": "" }, { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "hypermethioninemia encephalopathy due to adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "adenosine kinase deficiency", "description": "A rare inborn error of metabolism characterized by persistent hypermethioninemia with increased levels of S-adenosylmethionine and S-adenosylhomocysteine which manifests with encephalopathy, severe global developmental delay, mild to severe liver dysfunction, hypotonia and facial dysmorphism (most significant is frontal bossing, macrocephaly, hypertelorism and depressed nasal bridge). Epileptic seizures, hypoglycemia and/or cardiac defects (pulmonary stenosis, atrial and/or ventricular septal defect, coarctation of the aorta) may be associated. Clinical picture may range from neurological symptoms only to multi-organ involvement." }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "ADK deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "ADK hypermethioninemia", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "MRT8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "autosomal recessive intellectual disability 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "autosomal recessive mental retardation 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia due to adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia encephalopathy due to ADK deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia encephalopathy due to adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8, formerly", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8; MRT8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "adenosine kinase deficiency", "description": "A rare inborn error of metabolism characterized by persistent hypermethioninemia with increased levels of S-adenosylmethionine and S-adenosylhomocysteine which manifests with encephalopathy, severe global developmental delay, mild to severe liver dysfunction, hypotonia and facial dysmorphism (most significant is frontal bossing, macrocephaly, hypertelorism and depressed nasal bridge). Epileptic seizures, hypoglycemia and/or cardiac defects (pulmonary stenosis, atrial and/or ventricular septal defect, coarctation of the aorta) may be associated. Clinical picture may range from neurological symptoms only to multi-organ involvement." }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "ADK deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "ADK hypermethioninemia", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "MRT8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "autosomal recessive intellectual disability 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "autosomal recessive mental retardation 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia due to adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia encephalopathy due to ADK deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia encephalopathy due to adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8, formerly", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8; MRT8", "description": "" }, { "id": "MIM:614300", "resource": "MIM", "url": "https://www.omim.org/entry/614300", "name": "Hypermethioninemia due to adenosine kinase deficiency", "description": "Hypermethioninemia due to adenosine kinase deficiency" } ], "evidence": [ { "id": "0111038", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111038" } ] }, { "disease_id": "DOID:3328", "recommended_name": { "id": "DOID:3328", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3328", "name": "temporal lobe epilepsy", "description": "A focal epilepsy that is characterized by recurrent, unprovoked focal seizures that originate in the temporal lobe of the brain and last about one or two minutes." }, "synonyms": [ { "id": "DOID:3328", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3328", "name": "epilepsy, temporal lobe", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, familial temporal lobe, 1", "description": "An autosomal dominant condition caused by mutation(s) in the LGI1 gene, encoding leucine-rich glioma-inactivated protein 1. It is characterized by partial seizures originating in the temporal lobe and often accompanied by auditory sensory manifestations." }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "ETL1", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, familial temporal lobe, type 1", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, lateral temporal lobe, autosomal dominant", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, partial, with auditory features", "description": "" }, { "id": "MIM:600512", "resource": "MIM", "url": "https://www.omim.org/entry/600512", "name": "Epilepsy, familial temporal lobe, 1", "description": "Epilepsy, familial temporal lobe, 1" } ], "evidence": [ { "id": "3328", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3328" } ] }, { "disease_id": "DOID:3454", "recommended_name": { "id": "DOID:3454", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3454", "name": "brain infarction", "description": "A cerebrovascular disease that is characterized by tissue necrosis located_in the brain, resulting from inadequate blood flow through the brain." }, "synonyms": [], "evidence": [ { "id": "3454", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3454" } ] }, { "disease_id": "DOID:9452", "recommended_name": { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "steatotic liver disease", "description": "A lipid storage disease characterized by the accumulation of large vacuoles of triglyceride fat in at least 5% of hepatocytes." }, "synonyms": [ { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "SLD", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "fatty liver disease", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "Fatty change of liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "Steatosis of liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "alcoholic fatty liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "hepatic lipidosis", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "hepatic steatosis", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "White liver disease", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatal neonatal hepatic steatosis", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatty liver disease, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatty metamorphosis of viscera", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "steatosis of liver", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis", "description": "" } ], "evidence": [ { "id": "9452", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9452" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "common_name": "Yeast" } ], "gene": [ { "name": "ADO1", "url": "https://www.uniprot.org/uniprot/P47143", "locus": {} } ], "crossref": [ { "id": "cd01168", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01168", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "853569", "url": "https://www.ncbi.nlm.nih.gov/gene/853569", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P47143", "url": "https://www.ebi.ac.uk/intact/interactors/id:P47143*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001805", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001805", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002173", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002173", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011611", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011611", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029056", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029056", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YJR105W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YJR105W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "APFIAQF", "url": "https://omabrowser.org/oma/group/APFIAQF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "22683at2759", "url": "http://www.orthodb.org/?query=22683at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45769", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45769", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45769:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45769:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00294", "url": "http://pfam.xfam.org/family/PF00294", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P47143", "url": "http://purl.obolibrary.org/obo/PR_P47143", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012639", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012639", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000003866", "url": "https://www.yeastgenome.org/locus/S000003866", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P47143-1", "url": "https://www.uniprot.org/uniprot/P47143-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTAPLVVLGNPLLDFQADVTAEYLAKYSLKENDAILVDAKSGDAKMAIFDELLQMPETKLVAGGAAQNTARGAAYVLGAGQVVYFGSVGKDKFSERLLNENEKAGVKSMYQVQNDIGTGKCAALITGHNRSLVTDLGAANFFTPDHLDKHWDLVEAAKLFYIGGFHLTVSPDAIVKLGQHAKENSKPFVLNFSAPFIPHVFKDALARVLPYATVIIANESEAEAFCDAFQLDCANTDLEAIAQRIVKDSPVEKTVIFTHGVEPTVVVSSKGTSTYPVKPLDSSKIVDTNGAGDAFAGGFMAGLTKGEDLETSIDMGQWLAALSIQEVGPSYPSEKISYSK", "length": 340, "header": "sp|P47143-1|ADK_YEAST Isoform 1 of Adenosine kinase OS=Saccharomyces cerevisiae S288C OX=559292 GN=ADO1 PE=1 SV=1 CANONICAL=P47143-1" }, "isoforms": [ { "isoform_ac": "P47143-1", "url": "", "sequence": { "sequence": "MTAPLVVLGNPLLDFQADVTAEYLAKYSLKENDAILVDAKSGDAKMAIFDELLQMPETKLVAGGAAQNTARGAAYVLGAGQVVYFGSVGKDKFSERLLNENEKAGVKSMYQVQNDIGTGKCAALITGHNRSLVTDLGAANFFTPDHLDKHWDLVEAAKLFYIGGFHLTVSPDAIVKLGQHAKENSKPFVLNFSAPFIPHVFKDALARVLPYATVIIANESEAEAFCDAFQLDCANTDLEAIAQRIVKDSPVEKTVIFTHGVEPTVVVSSKGTSTYPVKPLDSSKIVDTNGAGDAFAGGFMAGLTKGEDLETSIDMGQWLAALSIQEVGPSYPSEKISYSK", "length": 340, "header": "sp|P47143-1|ADK_YEAST Isoform 1 of Adenosine kinase OS=Saccharomyces cerevisiae S288C OX=559292 GN=ADO1 PE=1 SV=1 CANONICAL=P47143-1" }, "locus": { "chromosome": "X", "start_pos": 624600, "end_pos": 623581, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YJR105W_mRNA", "url": "https://www.ensembl.org/id/YJR105W_mRNA" }, { "database": "Ensembl Peptide", "id": "YJR105W", "url": "https://www.ensembl.org/id/YJR105W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P47143", "url": "https://www.yeastgenome.org/locus/P47143" }, { "database": "iPTMnet", "id": "P47143", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47143" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser249" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Role of adenosine kinase in Saccharomyces cerevisiae: identification of the ADO1 gene and study of the mutant phenotypes.", "journal": "Yeast", "date": "2001", "authors": "Desgranges C., Daignan-Fornier B., Lecoq K., Belloc I.", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "reference": [ { "type": "PubMed", "id": "11223943", "url": "https://glygen.org/publication/PubMed/11223943" } ] }, { "title": "Expression in Escherichia coli of a recombinant adenosine kinase from Saccharomyces cerevisiae: purification, kinetics and substrate analyses.", "journal": "Yeast", "date": "2003", "authors": "Rodriguez M.J., Jimenez A., Barrado P., Lobato M.F.", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "reference": [ { "type": "PubMed", "id": "14558146", "url": "https://glygen.org/publication/PubMed/14558146" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P47143", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47143" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X.", "journal": "EMBO J.", "date": "1996", "authors": "Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Pujol A., Galibert F., Rose M., Boles E., Durand P., Portetelle D., Zagulski M., Kleine K., Manus V., Rossau R., Cziepluch C., Jauniaux J.-C., Soriano N., Chuat J.-C., Koetter P., Entian K.-D., Kordes E., Louis E.J., Hollenberg C.P., Vandenbol M., Domdey H., Pohl T.M., Scarcez T., Goffeau A., Grivell L.A., Herbert C.J., Hilger F., Jacq C., Miosga T., Perea J., Schaaff-Gerstenschlaeger I., Zollner A., Alexandraki D., Huang M.-E., Kirchrath L., Purnelle B., Ramezani Rad M., Tzermia M., Baur A., Chalwatzis N., Coster F., Gatius M., Hennemann A., Heumann K., Karpfinger-Hartl L., Katsoulou C., Liebl S., Rasmussen S.W., Smits P.H.M., To Van D., Van Broekhoven A., de Haan M., von Wettstein D.", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "reference": [ { "type": "PubMed", "id": "8641269", "url": "https://glygen.org/publication/PubMed/8641269" } ] } ], "pathway": [ { "id": "sce:YJR105W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YJR105W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "pmid": "" }, { "name": "adenosine kinase activity", "id": "GO:0004001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004001", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "pmid": "" }, { "name": "AMP salvage", "id": "GO:0044209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044209", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "pmid": "" }, { "name": "purine ribonucleoside salvage", "id": "GO:0006166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006166", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "pmid": "" }, { "name": "purine nucleobase metabolic process", "id": "GO:0006144", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006144", "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprot/P47143" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 129, "end_pos": 131, "annotation": "n_glycosylation_sequon" }, { "start_pos": 191, "end_pos": 193, "annotation": "n_glycosylation_sequon" }, { "start_pos": 218, "end_pos": 220, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "20824", "name": "", "equation": "adenosine + ATP = ADP + AMP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64640-1", "P55263-1", "P55264-1", "P47143-1", "Q54MB5-1", "Q7JWW6-1", "Q9VU38-1", "Q8T3U8-1" ], "evidence": [ { "id": "20824", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/20824" } ] }, { "id": "R-SCE-109624", "name": "(2'-deoxy)adenosine + ATP => (d)AMP + ADP (ADK)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47143-1" ], "evidence": [ { "id": "R-SCE-109624", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-109624" } ] }, { "id": "R-SCE-9754974", "name": "ADK phosphorylates RBV", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9680963" ], "output_participant_list": [ "R-ALL-9755028" ], "enzyme_list": [ "P47143-1" ], "evidence": [ { "id": "R-SCE-9754974", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-9754974" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-9680963", "participant_name": "RBV [cytosol]", "crossref": [ { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" }, { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" }, { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" }, { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" }, { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" } ] }, { "participant_id": "R-ALL-9755028", "participant_name": "RBV-MP [cytosol]", "crossref": [ { "id": "189091", "database": "ChEBI", "url": "" }, { "id": "189091", "database": "ChEBI", "url": "" }, { "id": "189091", "database": "ChEBI", "url": "" }, { "id": "189091", "database": "ChEBI", "url": "" }, { "id": "189091", "database": "ChEBI", "url": "" }, { "id": "189091", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P47143", "gene_name": "ADO1", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "P47143", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47143" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "P47143", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47143" } ] } ] }, { "uniprot_ac": "P55263", "gene_name": "ADK", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "P55263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55263" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "P55263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55263" } ] } ] }, { "uniprot_ac": "P55264", "gene_name": "Adk", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "P55264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55264" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "P55264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55264" } ] } ] }, { "uniprot_ac": "Q54MB5", "gene_name": "adk", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "Q54MB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MB5" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "Q54MB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MB5" } ] } ] }, { "uniprot_ac": "Q64640", "gene_name": "Adk", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "Q64640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64640" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "Q64640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64640" } ] } ] }, { "uniprot_ac": "Q7JWW6", "gene_name": "Adk3", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "Q7JWW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JWW6" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "Q7JWW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JWW6" } ] } ] }, { "uniprot_ac": "Q8T3U8", "gene_name": "Adk1", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "Q8T3U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T3U8" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "Q8T3U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T3U8" } ] } ] }, { "uniprot_ac": "Q9VU38", "gene_name": "Adk2", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "Q9VU38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "Q9VU38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }