{ "uniprot_canonical_ac": "P47030-1", "uniprot_ac": "P47030", "uniprot_id": "TAX4_YEAST", "mass": { "chemical_mass": 68768.0, "monoisotopic_mass": 68768.0 }, "refseq": { "ac": "NP_012452", "name": "Tax4p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012452" }, "gene_names": [ { "name": "TAX4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P47030", "id": "P47030" }, { "name": "J1002", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P47030", "id": "P47030" }, { "name": "TAX4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012452", "id": "NP_012452" } ], "protein_names": [ { "name": "Protein TAX4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P47030" }, { "name": "Tax4p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012452", "id": "NP_012452" } ], "function": [ { "annotation": "With IRS4, acts as a positive regulator of INP51 activity and phosphatidylinositol 4,5-bisphosphate turnover. Negatively regulates signaling through the cell integrity pathway, including the MAP kinase SLT2.", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030#function" }, { "database": "PubMed", "id": "15265867", "url": "https://glygen.org/publication/PubMed/15265867" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "common_name": "Yeast" } ], "gene": [ { "name": "TAX4", "url": "https://www.uniprot.org/uniprot/P47030", "locus": {} } ], "crossref": [ { "id": "cd00052", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00052", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "853362", "url": "https://www.ncbi.nlm.nih.gov/gene/853362", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P47030", "url": "https://www.ebi.ac.uk/intact/interactors/id:P47030*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000261", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000261", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YJL083W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YJL083W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "RSSXVGS", "url": "https://omabrowser.org/oma/group/RSSXVGS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1333804at2759", "url": "http://www.orthodb.org/?query=1333804at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_P47030", "url": "http://purl.obolibrary.org/obo/PR_P47030", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012452", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000003619", "url": "https://www.yeastgenome.org/locus/S000003619", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P47030-1", "url": "https://www.uniprot.org/uniprot/P47030-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MHFPKKKHSGNLSVVELPKEALQDSLTAAQITFKRYAHPNGNAGSAERPRHLKVESAPVVKSEPSLPRMRQPEPRSINHQYSRETLPGHSEAFSVPTTPLQTIHYDVRNKASNSPSSIAAAETAAYLAHTNSFSNRSSGVGSRDPVMDTETKPPRAPSALKNELQLNRMRIPPPSYDNNVRSRSISPQVSYSTSLSSSCSISSDGEETSYREKSTDEAFPPEPSMSSYSLASKASAKASLTDPSQRQQESDYTAMNKLNGGNIIYKGTLPDLIPRSQRKTSKPRFKHRLLRSPEQQQENLSRVYSDQTQNGRAIINTQQNVKLKTTMRRGKYAITDNDETFPYDRKSVSSDSDTDEDSNVMEIKDKKKKSRRSKIKKGLKTTAAVVGSSTSVLPFPHHHHHHHQLHNPNSHHLHTHHHTSSHKFNEDKPWKSHRDLGFITEQERKRYESMWVSNRYSYLRLLPWWPSLANEDDESHLQPLNLPQDGLMLNLVVKDIWYRSNLPRDLLVQIYNMVDTRKDGTLDRKSFIVGMWLVDQCLYGRKLTNELDQRVWNSVDGYVLGTINVKPATSDHYHNANNPLDKPSKLSVRQELKNIKRDLRNVRI", "length": 604, "header": "sp|P47030-1|TAX4_YEAST Isoform 1 of Protein TAX4 OS=Saccharomyces cerevisiae S288C OX=559292 GN=TAX4 PE=1 SV=1 CANONICAL=P47030-1" }, "isoforms": [ { "isoform_ac": "P47030-1", "url": "", "sequence": { "sequence": "MHFPKKKHSGNLSVVELPKEALQDSLTAAQITFKRYAHPNGNAGSAERPRHLKVESAPVVKSEPSLPRMRQPEPRSINHQYSRETLPGHSEAFSVPTTPLQTIHYDVRNKASNSPSSIAAAETAAYLAHTNSFSNRSSGVGSRDPVMDTETKPPRAPSALKNELQLNRMRIPPPSYDNNVRSRSISPQVSYSTSLSSSCSISSDGEETSYREKSTDEAFPPEPSMSSYSLASKASAKASLTDPSQRQQESDYTAMNKLNGGNIIYKGTLPDLIPRSQRKTSKPRFKHRLLRSPEQQQENLSRVYSDQTQNGRAIINTQQNVKLKTTMRRGKYAITDNDETFPYDRKSVSSDSDTDEDSNVMEIKDKKKKSRRSKIKKGLKTTAAVVGSSTSVLPFPHHHHHHHQLHNPNSHHLHTHHHTSSHKFNEDKPWKSHRDLGFITEQERKRYESMWVSNRYSYLRLLPWWPSLANEDDESHLQPLNLPQDGLMLNLVVKDIWYRSNLPRDLLVQIYNMVDTRKDGTLDRKSFIVGMWLVDQCLYGRKLTNELDQRVWNSVDGYVLGTINVKPATSDHYHNANNPLDKPSKLSVRQELKNIKRDLRNVRI", "length": 604, "header": "sp|P47030-1|TAX4_YEAST Isoform 1 of Protein TAX4 OS=Saccharomyces cerevisiae S288C OX=559292 GN=TAX4 PE=1 SV=1 CANONICAL=P47030-1" }, "locus": { "chromosome": "X", "start_pos": 280652, "end_pos": 278841, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YJL083W_mRNA", "url": "https://www.ensembl.org/id/YJL083W_mRNA" }, { "database": "Ensembl Peptide", "id": "YJL083W", "url": "https://www.ensembl.org/id/YJL083W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Negative regulation of phosphatidylinositol 4,5-bisphosphate levels by the INP51-associated proteins TAX4 and IRS4.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Jenoe P., Hall M.N., Cooke F.T., Morales-Johansson H.", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "reference": [ { "type": "PubMed", "id": "15265867", "url": "https://glygen.org/publication/PubMed/15265867" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Sequence analysis of a 33.1 kb fragment from the left arm of Saccharomyces cerevisiae chromosome X, including putative proteins with leucine zippers, a fungal Zn(II)2-Cys6 binuclear cluster domain and a putative alpha 2-SCB-alpha 2 binding site.", "journal": "Yeast", "date": "1995", "authors": "Boles E., Schmitt S., Miosga T., Schaaff-Gerstenschlaeger I., Zimmermann F.K., Wilhelm N., Baur A., Chalwatzis N., Fournier C., Velten C.", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "reference": [ { "type": "PubMed", "id": "7483841", "url": "https://glygen.org/publication/PubMed/7483841" } ] }, { "title": "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X.", "journal": "EMBO J.", "date": "1996", "authors": "Mewes H.-W., Obermaier B., Wambutt R., Wedler H., Pujol A., Galibert F., Rose M., Boles E., Durand P., Portetelle D., Zagulski M., Kleine K., Manus V., Rossau R., Cziepluch C., Jauniaux J.-C., Soriano N., Chuat J.-C., Koetter P., Entian K.-D., Kordes E., Louis E.J., Hollenberg C.P., Vandenbol M., Domdey H., Pohl T.M., Scarcez T., Goffeau A., Grivell L.A., Herbert C.J., Hilger F., Jacq C., Miosga T., Perea J., Schaaff-Gerstenschlaeger I., Zollner A., Alexandraki D., Huang M.-E., Kirchrath L., Purnelle B., Ramezani Rad M., Tzermia M., Baur A., Chalwatzis N., Coster F., Gatius M., Hennemann A., Heumann K., Karpfinger-Hartl L., Katsoulou C., Liebl S., Rasmussen S.W., Smits P.H.M., To Van D., Van Broekhoven A., de Haan M., von Wettstein D.", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "reference": [ { "type": "PubMed", "id": "8641269", "url": "https://glygen.org/publication/PubMed/8641269" } ] }, { "title": "Recognition specificity of individual EH domains of mammals and yeast.", "journal": "EMBO J.", "date": "1998", "authors": "Cesareni G., Confalonieri S., Di Fiore P.P., Pelicci P.G., Salcini A.E., Castagnoli L., Coda L., Fre' S., Lauro I., Paoluzi S.", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "reference": [ { "type": "PubMed", "id": "9822599", "url": "https://glygen.org/publication/PubMed/9822599" } ] } ], "pathway": [ { "id": "sce:YJL083W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YJL083W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "pmid": "" }, { "name": "autophagy", "id": "GO:0006914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006914", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "pmid": "" }, { "name": "cellular response to starvation", "id": "GO:0009267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009267", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "pmid": "" }, { "name": "inositol lipid-mediated signaling", "id": "GO:0048017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048017", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "pmid": "" }, { "name": "fungal-type cell wall organization", "id": "GO:0031505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031505", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "phagophore assembly site", "id": "GO:0000407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000407", "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprot/P47030" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 11, "end_pos": 13, "annotation": "n_glycosylation_sequon" }, { "start_pos": 135, "end_pos": 137, "annotation": "n_glycosylation_sequon" }, { "start_pos": 299, "end_pos": 301, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }