{ "uniprot_canonical_ac": "P46681-1", "uniprot_ac": "P46681", "uniprot_id": "DLD2_YEAST", "mass": { "chemical_mass": 59268.0, "monoisotopic_mass": 59268.0 }, "refseq": { "ac": "NP_010103", "name": "D-lactate dehydrogenase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010103" }, "gene_names": [ { "name": "DLD2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P46681", "id": "P46681" }, { "name": "AIP2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010103", "id": "NP_010103" }, { "name": "AIP2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P46681", "id": "P46681" }, { "name": "DLD2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010103", "id": "NP_010103" } ], "protein_names": [ { "name": "D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P46681" }, { "name": "1.1.2.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P46681" }, { "name": "1.1.99.40", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P46681" }, { "name": "Actin-interacting protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P46681" }, { "name": "D-2HG--pyruvate transhydrogenase DLD2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P46681" }, { "name": "D-LCR", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P46681" }, { "name": "D-lactate dehydrogenase [cytochrome] 2, mitochondrial", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P46681" }, { "name": "D-lactate dehydrogenase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010103", "id": "NP_010103" }, { "name": "D-lactate ferricytochrome C oxidoreductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P46681" } ], "function": [ { "annotation": "Catalyzes the reversible oxidation of (R)-2-hydroxyglutarate to 2-oxoglutarate coupled to reduction of pyruvate to (R)-lactate. Can also use oxaloacetate as electron acceptor instead of pyruvate producing (R)-malate (PubMed:26774271). In addition to its enzymatic role it could play an important role in the yeast cell morphology (PubMed:10509019).", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681#function" }, { "database": "PubMed", "id": "26774271", "url": "https://glygen.org/publication/PubMed/26774271" }, { "database": "PubMed", "id": "10509019", "url": "https://glygen.org/publication/PubMed/10509019" } ] } ], "disease": [ { "disease_id": "DOID:0111351", "recommended_name": { "id": "DOID:0111351", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111351", "name": "D-2-hydroxyglutaric aciduria 1", "description": "A D-2-hydroxyglutaric aciduria that has_material_basis_in homozygous or compound heterozygous mutation in D2HGDH on 2q37.3." }, "synonyms": [ { "id": "DOID:0111351", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111351", "name": "D2HGA1", "description": "" }, { "id": "MONDO:0024554", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024554", "name": "D-2-hydroxyglutaric aciduria 1", "description": "Any D-2-hydroxyglutaric aciduria in which the cause of the disease is a mutation in the D2HGDH gene." }, { "id": "MONDO:0024554", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024554", "name": "D-2-hydroxyglutaric aciduria", "description": "" }, { "id": "MONDO:0024554", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024554", "name": "D-2-hydroxyglutaric aciduria 1", "description": "" }, { "id": "MONDO:0024554", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024554", "name": "D-2-hydroxyglutaric aciduria caused by mutation in D2HGDH", "description": "" }, { "id": "MONDO:0024554", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024554", "name": "D2HGDH D-2-hydroxyglutaric aciduria", "description": "" }, { "id": "MONDO:0024554", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024554", "name": "D2HGA1", "description": "" }, { "id": "MIM:600721", "resource": "MIM", "url": "https://www.omim.org/entry/600721", "name": "D-2-hydroxyglutaric aciduria 1", "description": "D-2-hydroxyglutaric aciduria 1" } ], "evidence": [ { "id": "0111351", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111351" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "common_name": "Yeast" } ], "gene": [ { "name": "DLD2", "url": "https://www.uniprot.org/uniprot/P46681", "locus": { "chromosome": "IV", "start_pos": 141114, "end_pos": 139522, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "YDL178W", "url": "https://www.ensembl.org/id/YDL178W" } ] } } ], "crossref": [ { "id": "851376", "url": "https://www.ncbi.nlm.nih.gov/gene/851376", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P46681", "url": "https://www.ebi.ac.uk/intact/interactors/id:P46681*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004113", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004113", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006094", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006094", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016166", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016166", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016167", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016167", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016169", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016169", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016171", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016171", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036318", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036318", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YDL178W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDL178W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TPRTCGE", "url": "https://omabrowser.org/oma/group/TPRTCGE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1664005at2759", "url": "http://www.orthodb.org/?query=1664005at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43716", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43716", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43716:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43716:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01565", "url": "http://pfam.xfam.org/family/PF01565", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02913", "url": "http://pfam.xfam.org/family/PF02913", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P46681", "url": "http://purl.obolibrary.org/obo/PR_P46681", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010103", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010103", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002337", "url": "https://www.yeastgenome.org/locus/S000002337", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P46681-1", "url": "https://www.uniprot.org/uniprot/P46681-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLRNILVRSTGSNFKFAGRYMKSSALLGYYRRVNYYSTKIQTRLTSENYPDVHRDPRFKKLTSDDLNYFKSILSEQEILRASESEDLSFYNEDWMRKYKGQSKLVLRPKSVEKVSLILNYCNDEKIAVVPQGGNTGLVGGSVPIFDELILSLANLNKIRDFDPVSGILKCDAGVILENANNYVMEQNYMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNSMHSMRKDNTGYDLKQLFIGSEGTIGIITGVSILTVPKPKAFNVSYLSVESFEDVQKVFVRARQELSEILSAFEFMDAKSQVLAKSQLKDAAFPLEDEHPFYILIETSGSNKDHDDSKLETFLENVMEEGIVTDGVVAQDETELQNLWKWREMIPEASQANGGVYKYDVSLPLKDLYSLVEATNARLSEAELVGDSPKPVVGAIGYGHVGDGNLHLNVAVREYNKNIEKTLEPFVYEFVSSKHGSVSAEHGLGFQKKNYIGYSKSPEEVKMMKDLKVHYDPNGILNPYKYI", "length": 530, "header": "sp|P46681-1|DLD2_YEAST Isoform 1 of D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=DLD2 PE=1 SV=1 CANONICAL=P46681-1" }, "isoforms": [ { "isoform_ac": "P46681-1", "url": "", "sequence": { "sequence": "MLRNILVRSTGSNFKFAGRYMKSSALLGYYRRVNYYSTKIQTRLTSENYPDVHRDPRFKKLTSDDLNYFKSILSEQEILRASESEDLSFYNEDWMRKYKGQSKLVLRPKSVEKVSLILNYCNDEKIAVVPQGGNTGLVGGSVPIFDELILSLANLNKIRDFDPVSGILKCDAGVILENANNYVMEQNYMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNSMHSMRKDNTGYDLKQLFIGSEGTIGIITGVSILTVPKPKAFNVSYLSVESFEDVQKVFVRARQELSEILSAFEFMDAKSQVLAKSQLKDAAFPLEDEHPFYILIETSGSNKDHDDSKLETFLENVMEEGIVTDGVVAQDETELQNLWKWREMIPEASQANGGVYKYDVSLPLKDLYSLVEATNARLSEAELVGDSPKPVVGAIGYGHVGDGNLHLNVAVREYNKNIEKTLEPFVYEFVSSKHGSVSAEHGLGFQKKNYIGYSKSPEEVKMMKDLKVHYDPNGILNPYKYI", "length": 530, "header": "sp|P46681-1|DLD2_YEAST Isoform 1 of D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=DLD2 PE=1 SV=1 CANONICAL=P46681-1" }, "locus": { "chromosome": "IV", "start_pos": 141111, "end_pos": 139522, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YDL178W_mRNA", "url": "https://www.ensembl.org/id/YDL178W_mRNA" }, { "database": "Ensembl Peptide", "id": "YDL178W", "url": "https://www.ensembl.org/id/YDL178W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Signalling between mitochondria and the nucleus regulates the expression of a new D-lactate dehydrogenase activity in yeast.", "journal": "Yeast", "date": "1999", "authors": "Liu Z., Jia Y., Butow R.A., Amberg D., Chelstowska A.", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "reference": [ { "type": "PubMed", "id": "10509019", "url": "https://glygen.org/publication/PubMed/10509019" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Interaction of D-lactate dehydrogenase protein 2 (Dld2p) with F-actin: implication for an alternative function of Dld2p.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2004", "authors": "Kaneko K., Tsukita S., Hachiya N.S., Jozuka A., Sakasegawa Y.", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "reference": [ { "type": "PubMed", "id": "15158445", "url": "https://glygen.org/publication/PubMed/15158445" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Saccharomyces cerevisiae forms D-2-hydroxyglutarate and couples its degradation to D-lactate formation via a cytosolic transhydrogenase.", "journal": "J. Biol. Chem.", "date": "2016", "authors": "Linster C.L., Paczia N., Becker-Kettern J., Conrotte J.F., Kay D.P., Guignard C., Jung P.P.", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "reference": [ { "type": "PubMed", "id": "26774271", "url": "https://glygen.org/publication/PubMed/26774271" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] } ], "pathway": [ { "id": "sce:YDL178W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDL178W", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8CIM3-1", "protein_name": "D-2-hydroxyglutarate dehydrogenase, mitochondrial", "gene_name": "D2hgdh", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVLPLVSRWSARVLWASPGWRRTYTQRACVGLKRLGCPRGVYSPLAHRAYSVVAGGPEVTLTPERYPVQRLPFSTVSEEDLAAFECIIPGRVITDPEQLQTCNVDWLKTVRGCSKVLLRPQTSEEVSQILRHCYKRNLAVNPQGGNTGMVGGSVPVFDEVILSTALMNQVISFHDVSGILVCQAGCVLEELSRYVQERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLRGTVLGLEVVLADGTILNCLTSLRKDNTGYDLKQMFIGSEGTLGVITAVSIVCPPRPKAVNVAFLGCPGFAEVLQTFRTCRGMLGEILSAFEFMDTECMQLVGQHLQLTNPVQESPFYVLVETSGSSAGHDAEKLTNVLEQVLNSGLVTDGTMATDQRKVQMLWALRERITEALSRDGYVFKYDLSLPVERLYDLVIDLRTRLGPRAKHVVGYGHLGDGNLHLNVTAEAFSRELLGALEPYVYAWTAEQRGSVSAEHGLGFKKKDVLGYSKPPVAVTLMQQLKAMLDPEGILNPYKTLPAQA", "length": 535 }, "evidence": [ { "id": "P46681", "url": "https://omabrowser.org/oma/group/P46681/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8N465-1", "protein_name": "D-2-hydroxyglutarate dehydrogenase, mitochondrial", "gene_name": "D2HGDH", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MLPRRPLAWPAWLLRGAPGAAGSWGRPVGPLARRGCCSAPGTPEVPLTRERYPVRRLPFSTVSKQDLAAFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGILVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVNVAFLGCPGFAEVLQTFSTCKGMLGEILSAFEFMDAVCMQLVGRHLHLASPVQESPFYVLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKMLWALRERITEALSRDGYVYKYDLSLPVERLYDIVTDLRARLGPHAKHVVGYGHLGDGNLHLNVTAEAFSPSLLAALEPHVYEWTAGQQGSVSAEHGVGFRKRDVLGYSKPPGALQLMQQLKALLDPKGILNPYKTLPSQA", "length": 521 }, "evidence": [ { "id": "P46681", "url": "https://omabrowser.org/oma/group/P46681/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "pmid": "" }, { "name": "FAD binding", "id": "GO:0071949", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071949", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "pmid": "" }, { "name": "D-lactate dehydrogenase (cytochrome) activity", "id": "GO:0004458", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004458", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "pmid": "" }, { "name": "(R)-2-hydroxyglutarate dehydrogenase activity", "id": "GO:0051990", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051990", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "pmid": "" }, { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "lactate catabolic process", "id": "GO:1903457", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903457", "evidence": [ { "database": "UniProtKB", "id": "P46681", "url": "https://www.uniprot.org/uniprot/P46681" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 282, "end_pos": 284, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "13521", "name": "", "equation": "(R)-lactate + 2 Fe(III)-[cytochrome c] = 2 Fe(II)-[cytochrome c] + 2 H(+) + pyruvate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q86WU2-1", "Q7TNG8-1", "P32891-1", "P39976-1", "P46681-1" ], "evidence": [ { "id": "13521", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/13521" } ] }, { "id": "51608", "name": "", "equation": "(R)-2-hydroxyglutarate + pyruvate = (R)-lactate + 2-oxoglutarate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P39976-1", "P46681-1" ], "evidence": [ { "id": "51608", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/51608" } ] }, { "id": "R-SCE-880007", "name": "(R)-2-hydroxyglutarate + FAD => 2-oxoglutarate + FADH2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial matrix", "input_participant_list": [ "R-ALL-879997" ], "output_participant_list": [], "enzyme_list": [ "P46681-1" ], "evidence": [ { "id": "R-SCE-880007", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-880007" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-879997", "participant_name": "2HG [mitochondrial matrix]", "crossref": [ { "id": "000000402968", "database": "ZINC", "url": "" }, { "id": "32796", "database": "ChEBI", "url": "" }, { "id": "C01087", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000606", "database": "HMDB Metabolite", "url": "" }, { "id": "32796", "database": "ChEBI", "url": "" }, { "id": "000000402968", "database": "ZINC", "url": "" }, { "id": "C01087", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000606", "database": "HMDB Metabolite", "url": "" }, { "id": "C01087", "database": "COMPOUND", "url": "" }, { "id": "32796", "database": "ChEBI", "url": "" }, { "id": "HMDB0000606", "database": "HMDB Metabolite", "url": "" }, { "id": "000000402968", "database": "ZINC", "url": "" }, { "id": "32796", "database": "ChEBI", "url": "" }, { "id": "000000402968", "database": "ZINC", "url": "" }, { "id": "C01087", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000606", "database": "HMDB Metabolite", "url": "" }, { "id": "32796", "database": "ChEBI", "url": "" }, { "id": "000000402968", "database": "ZINC", "url": "" }, { "id": "C01087", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000606", "database": "HMDB Metabolite", "url": "" }, { "id": "32796", "database": "ChEBI", "url": "" }, { "id": "000000402968", "database": "ZINC", "url": "" }, { "id": "C01087", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000606", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P32891", "gene_name": "DLD1", "activity": [ { "ec_number": "1.1.2.4", "activity": "(R)-lactate + 2 Fe(III)-[cytochrome c] = 2 Fe(II)-[cytochrome c] + 2 H(+) + pyruvate.", "evidence": [ { "id": "P32891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32891" } ] }, { "ec_number": "1.1.2.4", "activity": "", "evidence": [ { "id": "P32891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32891" } ] } ] }, { "uniprot_ac": "P39976", "gene_name": "DLD3", "activity": [ { "ec_number": "1.1.2.4", "activity": "(R)-lactate + 2 Fe(III)-[cytochrome c] = 2 Fe(II)-[cytochrome c] + 2 H(+) + pyruvate.", "evidence": [ { "id": "P39976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39976" } ] }, { "ec_number": "1.1.99.40", "activity": "(R)-2-hydroxyglutarate + pyruvate = (R)-lactate + 2-oxoglutarate.", "evidence": [ { "id": "P39976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39976" } ] }, { "ec_number": "1.1.99.40", "activity": "", "evidence": [ { "id": "P39976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39976" } ] } ] }, { "uniprot_ac": "P46681", "gene_name": "DLD2", "activity": [ { "ec_number": "1.1.2.4", "activity": "(R)-lactate + 2 Fe(III)-[cytochrome c] = 2 Fe(II)-[cytochrome c] + 2 H(+) + pyruvate.", "evidence": [ { "id": "P46681", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46681" } ] }, { "ec_number": "1.1.99.40", "activity": "(R)-2-hydroxyglutarate + pyruvate = (R)-lactate + 2-oxoglutarate.", "evidence": [ { "id": "P46681", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46681" } ] }, { "ec_number": "1.1.99.40", "activity": "", "evidence": [ { "id": "P46681", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46681" } ] } ] }, { "uniprot_ac": "Q7TNG8", "gene_name": "Ldhd", "activity": [ { "ec_number": "1.1.2.4", "activity": "(R)-lactate + 2 Fe(III)-[cytochrome c] = 2 Fe(II)-[cytochrome c] + 2 H(+) + pyruvate.", "evidence": [ { "id": "Q7TNG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNG8" } ] }, { "ec_number": "1.1.2.4", "activity": "", "evidence": [ { "id": "Q7TNG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNG8" } ] } ] }, { "uniprot_ac": "Q86WU2", "gene_name": "LDHD", "activity": [ { "ec_number": "1.1.2.4", "activity": "(R)-lactate + 2 Fe(III)-[cytochrome c] = 2 Fe(II)-[cytochrome c] + 2 H(+) + pyruvate.", "evidence": [ { "id": "Q86WU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86WU2" } ] }, { "ec_number": "1.1.2.4", "activity": "", "evidence": [ { "id": "Q86WU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86WU2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }