{ "uniprot_canonical_ac": "P43618-1", "uniprot_ac": "P43618", "uniprot_id": "CENPT_YEAST", "mass": { "chemical_mass": 41313.0, "monoisotopic_mass": 41313.0 }, "refseq": { "ac": "NP_116704", "name": "centromere-binding protein CNN1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_116704" }, "gene_names": [ { "name": "CNN1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P43618", "id": "P43618" }, { "name": "CNN1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_116704", "id": "NP_116704" } ], "protein_names": [ { "name": "Inner kinetochore subunit CNN1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P43618" }, { "name": "CENP-T homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P43618" }, { "name": "Co-purified with NNF1 protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P43618" }, { "name": "Constitutive centromere-associated network protein CNN1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P43618" }, { "name": "centromere-binding protein CNN1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_116704", "id": "NP_116704" } ], "function": [ { "annotation": "Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:22561346). CNN1 is important for the recruitment of the outer kinetochore Ndc80 complex (PubMed:23334295).", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618#function" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" }, { "database": "PubMed", "id": "22561346", "url": "https://glygen.org/publication/PubMed/22561346" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 74, "end_pos": 74, "sequence_org": "S", "sequence_mut": "A", "comment": "Increases interaction with SPC24-SPC25.", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ] }, { "start_pos": 74, "end_pos": 74, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes interaction with SPC24-SPC25.", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "common_name": "Yeast" } ], "gene": [ { "name": "CNN1", "url": "https://www.uniprot.org/uniprot/P43618", "locus": {} } ], "crossref": [ { "id": "850607", "url": "https://www.ncbi.nlm.nih.gov/gene/850607", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P43618", "url": "https://www.ebi.ac.uk/intact/interactors/id:P43618*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "sce:YFR046C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YFR046C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "XTEVSEI", "url": "https://omabrowser.org/oma/group/XTEVSEI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2036976at2759", "url": "http://www.orthodb.org/?query=2036976at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "4GEQ", "url": "https://www.rcsb.org/structure/4GEQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WUC", "url": "https://www.rcsb.org/structure/6WUC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YPC", "url": "https://www.rcsb.org/structure/6YPC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PR_P43618", "url": "http://purl.obolibrary.org/obo/PR_P43618", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_116704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_116704", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001942", "url": "https://www.yeastgenome.org/locus/S000001942", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P43618-1", "url": "https://www.uniprot.org/uniprot/P43618-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTPRKAAGNNENTEVSEIRTPFRERALEEQRLKDEVLIRNTPGYRKLLSASTKSHDILNKDPNEVRSFLQDLSQVLARKSQGNDTTTNKTQARNLIDELAYEESQPEENELLRSRSEKLTDNNIGNETQPDYTSLSQTVFAKLQERDKGLKSRKIDPIIIQDVPTTGHEDELTVHSPDKANSISMEVLRTSPSIGMDQVDEPPVRDPVPISITQQEEPLSEDLPSDDKEETEEAENEDYSFENTSDENLDDIGNDPIRLNVPAVRRSSIKPLQIMDLKHLTRQFLNENRIILPKQTWSTIQEESLNIMDFLKQKIGTLQKQELVDSFIDMGIINNVDDMFELAHELLPLELQSRIESYLF", "length": 361, "header": "sp|P43618-1|CENPT_YEAST Isoform 1 of Inner kinetochore subunit CNN1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=CNN1 PE=1 SV=1 CANONICAL=P43618-1" }, "isoforms": [ { "isoform_ac": "P43618-1", "url": "", "sequence": { "sequence": "MSTPRKAAGNNENTEVSEIRTPFRERALEEQRLKDEVLIRNTPGYRKLLSASTKSHDILNKDPNEVRSFLQDLSQVLARKSQGNDTTTNKTQARNLIDELAYEESQPEENELLRSRSEKLTDNNIGNETQPDYTSLSQTVFAKLQERDKGLKSRKIDPIIIQDVPTTGHEDELTVHSPDKANSISMEVLRTSPSIGMDQVDEPPVRDPVPISITQQEEPLSEDLPSDDKEETEEAENEDYSFENTSDENLDDIGNDPIRLNVPAVRRSSIKPLQIMDLKHLTRQFLNENRIILPKQTWSTIQEESLNIMDFLKQKIGTLQKQELVDSFIDMGIINNVDDMFELAHELLPLELQSRIESYLF", "length": 361, "header": "sp|P43618-1|CENPT_YEAST Isoform 1 of Inner kinetochore subunit CNN1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=CNN1 PE=1 SV=1 CANONICAL=P43618-1" }, "locus": { "chromosome": "VI", "start_pos": 244159, "end_pos": 243077, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YFR046C_mRNA", "url": "https://www.ensembl.org/id/YFR046C_mRNA" }, { "database": "Ensembl Peptide", "id": "YFR046C", "url": "https://www.ensembl.org/id/YFR046C" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 115, "end_pos": 115, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser115" }, { "start_pos": 129, "end_pos": 129, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1 and MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr129" }, { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr134" }, { "start_pos": 135, "end_pos": 135, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser135" }, { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1 and MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr139" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1 and MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "SGD", "id": "P43618", "url": "https://www.yeastgenome.org/locus/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "22561345", "url": "https://glygen.org/publication/PubMed/22561345" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr14" }, { "start_pos": 153, "end_pos": 153, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser153" }, { "start_pos": 174, "end_pos": 174, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "SGD", "id": "P43618", "url": "https://www.yeastgenome.org/locus/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "22561345", "url": "https://glygen.org/publication/PubMed/22561345" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr174" }, { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "SGD", "id": "P43618", "url": "https://www.yeastgenome.org/locus/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "22561345", "url": "https://glygen.org/publication/PubMed/22561345" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser177" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "SGD", "id": "P43618", "url": "https://www.yeastgenome.org/locus/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "22561345", "url": "https://glygen.org/publication/PubMed/22561345" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser17" }, { "start_pos": 191, "end_pos": 191, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr191" }, { "start_pos": 192, "end_pos": 192, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser192" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" }, { "database": "SGD", "id": "P43618", "url": "https://www.yeastgenome.org/locus/P43618" }, { "database": "PubMed", "id": "22561345", "url": "https://glygen.org/publication/PubMed/22561345" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr21" }, { "start_pos": 268, "end_pos": 268, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser268" }, { "start_pos": 269, "end_pos": 269, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P43618", "url": "https://www.yeastgenome.org/locus/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "22561345", "url": "https://glygen.org/publication/PubMed/22561345" } ], "site_lbl": "Ser269" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser2" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P43618", "url": "https://www.yeastgenome.org/locus/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "22561345", "url": "https://glygen.org/publication/PubMed/22561345" } ], "site_lbl": "Thr3" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr42" }, { "start_pos": 50, "end_pos": 50, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser50" }, { "start_pos": 52, "end_pos": 52, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser52" }, { "start_pos": 53, "end_pos": 53, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr53" }, { "start_pos": 55, "end_pos": 55, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser55" }, { "start_pos": 74, "end_pos": 74, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "SGD", "id": "P43618", "url": "https://www.yeastgenome.org/locus/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "22561345", "url": "https://glygen.org/publication/PubMed/22561345" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Ser74" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr86" }, { "start_pos": 88, "end_pos": 88, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr88" }, { "start_pos": 91, "end_pos": 91, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1 and MPS1", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ], "site_lbl": "Thr91" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Hierarchical assembly of the budding yeast kinetochore from multiple subcomplexes.", "journal": "Genes Dev.", "date": "2003", "authors": "McAinsh A.D., Sorger P.K., De Wulf P.", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "reference": [ { "type": "PubMed", "id": "14633972", "url": "https://glygen.org/publication/PubMed/14633972" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science", "date": "2009", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "A global protein kinase and phosphatase interaction network in yeast.", "journal": "Science (New York, N.Y.)", "date": "2010-05-21", "authors": "Breitkreutz Ashton, Choi Hyungwon, Sharom Jeffrey R, Boucher Lorrie, Neduva Victor, Larsen Brett, Lin Zhen-Yuan, Breitkreutz Bobby-Joe, Stark Chris, Liu Guomin, Ahn Jessica, Dewar-Darch Danielle, Reguly Teresa, Tang Xiaojing, Almeida Ricardo, Qin Zhaohui Steve, Pawson Tony, Gingras Anne-Claude, Nesvizhskii Alexey I, Tyers Mike", "evidence": [ { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" } ], "reference": [ { "type": "PubMed", "id": "20489023", "url": "https://glygen.org/publication/PubMed/20489023" } ] }, { "title": "Cnn1 inhibits the interactions between the KMN complexes of the yeast kinetochore.", "journal": "Nature cell biology", "date": "2012-05-06", "authors": "Bock Lucy J, Pagliuca Cinzia, Kobayashi Norihiko, Grove Ryan A, Oku Yusuke, Shrestha Kriti, Alfieri Claudio, Golfieri Cristina, Oldani Amanda, Dal Maschio Marianna, Bermejo Rodrigo, Hazbun Tony R, Tanaka Tomoyuki U, De Wulf Peter", "evidence": [ { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" } ], "reference": [ { "type": "PubMed", "id": "22561345", "url": "https://glygen.org/publication/PubMed/22561345" } ] }, { "title": "CENP-T proteins are conserved centromere receptors of the Ndc80 complex.", "journal": "Nat. Cell Biol.", "date": "2012", "authors": "Mechtler K., Schleiffer A., Lampert F., Maier M., Litos G., Westermann S., Hornung P.", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "reference": [ { "type": "PubMed", "id": "22561346", "url": "https://glygen.org/publication/PubMed/22561346" } ] }, { "title": "A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors.", "journal": "EMBO J.", "date": "2013", "authors": "Malvezzi Francesca, Litos Gabriele, Schleiffer Alexander, Heuck Alexander, Mechtler Karl, Clausen Tim, Westermann Stefan", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" } ], "reference": [ { "type": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P43618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43618" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae.", "journal": "Nat. Genet.", "date": "1995", "authors": "Soeda E., Tashiro H., Yamazaki M., Yokoyama K., Hagiwara H., Murakami Y., Shibata T., Ozawa M., Eki T., Tsuchiya Y., Sasanuma S., Naitou M., Sasanuma M.", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "reference": [ { "type": "PubMed", "id": "7670463", "url": "https://glygen.org/publication/PubMed/7670463" } ] }, { "title": "Analysis of a 36.2 kb DNA sequence including the right telomere of chromosome VI from Saccharomyces cerevisiae.", "journal": "Yeast", "date": "1996", "authors": "Hagiwara H., Murakami Y., Shibata T., Hanaoka F., Ozawa M., Eki T., Tsuchiya Y., Sasanuma S., Naitou M., Sasanuma M.", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "reference": [ { "type": "PubMed", "id": "8686379", "url": "https://glygen.org/publication/PubMed/8686379" } ] } ], "pathway": [ { "id": "sce:YFR046C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YFR046C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "pmid": "" }, { "name": "kinetochore", "id": "GO:0000776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000776", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "chromosome segregation", "id": "GO:0007059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007059", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "pmid": "" }, { "name": "negative regulation of kinetochore assembly", "id": "GO:1905560", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905560", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "pmid": "" }, { "name": "centromeric DNA binding", "id": "GO:0019237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019237", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 127, "end_pos": 129, "annotation": "n_glycosylation_sequon" }, { "start_pos": 244, "end_pos": 246, "annotation": "n_glycosylation_sequon" }, { "start_pos": 84, "end_pos": 86, "annotation": "n_glycosylation_sequon" }, { "start_pos": 89, "end_pos": 91, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation of the C-ter by MPS1 kinase regulates interaction with the outer kinetochore Ndc80 complex.", "evidence": [ { "database": "UniProtKB", "id": "P43618", "url": "https://www.uniprot.org/uniprot/P43618" }, { "database": "PubMed", "id": "23334295", "url": "https://glygen.org/publication/PubMed/23334295" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 26 }, { "field": "total_sites", "count": 26 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }