{ "uniprot_canonical_ac": "P43615-1", "uniprot_ac": "P43615", "uniprot_id": "IRC6_YEAST", "mass": { "chemical_mass": 27879.0, "monoisotopic_mass": 27879.0 }, "refseq": { "ac": "NP_116701", "name": "Irc6p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_116701" }, "gene_names": [ { "name": "IRC6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P43615", "id": "P43615" }, { "name": "IRC6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_116701", "id": "NP_116701" } ], "protein_names": [ { "name": "Increased recombination centers protein 6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P43615" }, { "name": "Irc6p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_116701", "id": "NP_116701" } ], "function": [ { "annotation": "Involved in gross chromosomal rearrangements (GCRs) and telomere healing.", "evidence": [ { "database": "UniProtKB", "id": "P43615", "url": "https://www.uniprot.org/uniprot/P43615#function" }, { "database": "PubMed", "id": "20194442", "url": "https://glygen.org/publication/PubMed/20194442" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43615", "url": "https://www.uniprot.org/uniprot/P43615" } ], "common_name": "Yeast" } ], "gene": [ { "name": "IRC6", "url": "https://www.uniprot.org/uniprot/P43615", "locus": {} } ], "crossref": [ { "id": "850604", "url": "https://www.ncbi.nlm.nih.gov/gene/850604", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P43615", "url": "https://www.ebi.ac.uk/intact/interactors/id:P43615*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR034627", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034627", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YFR043C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YFR043C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KWKTKYY", "url": "https://omabrowser.org/oma/group/KWKTKYY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2016445at2759", "url": "http://www.orthodb.org/?query=2016445at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28043", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28043", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28043:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28043:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3UC9", "url": "https://www.rcsb.org/structure/3UC9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PR_P43615", "url": "http://purl.obolibrary.org/obo/PR_P43615", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_116701", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_116701", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001939", "url": "https://www.yeastgenome.org/locus/S000001939", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P43615", "url": "https://www.uniprot.org/uniprot/P43615", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P43615-1", "url": "https://www.uniprot.org/uniprot/P43615-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVLQYPQNKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDSCKEIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVLANVNEEVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLNCEVQPATKIREEIPNEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELSRYL", "length": 237, "header": "sp|P43615-1|IRC6_YEAST Isoform 1 of Increased recombination centers protein 6 OS=Saccharomyces cerevisiae S288C OX=559292 GN=IRC6 PE=1 SV=1 CANONICAL=P43615-1" }, "isoforms": [ { "isoform_ac": "P43615-1", "url": "", "sequence": { "sequence": "MVLQYPQNKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDSCKEIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVLANVNEEVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLNCEVQPATKIREEIPNEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELSRYL", "length": 237, "header": "sp|P43615-1|IRC6_YEAST Isoform 1 of Increased recombination centers protein 6 OS=Saccharomyces cerevisiae S288C OX=559292 GN=IRC6 PE=1 SV=1 CANONICAL=P43615-1" }, "locus": { "chromosome": "VI", "start_pos": 239827, "end_pos": 239117, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YFR043C_mRNA", "url": "https://www.ensembl.org/id/YFR043C_mRNA" }, { "database": "Ensembl Peptide", "id": "YFR043C", "url": "https://www.ensembl.org/id/YFR043C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Genome-wide analysis of Rad52 foci reveals diverse mechanisms impacting recombination.", "journal": "PLoS Genet.", "date": "2007", "authors": "Lisby M., Rothstein R., Alvaro D.", "evidence": [ { "database": "UniProtKB", "id": "P43615", "url": "https://www.uniprot.org/uniprot/P43615" } ], "reference": [ { "type": "PubMed", "id": "18085829", "url": "https://glygen.org/publication/PubMed/18085829" } ] }, { "title": "De novo telomere formation is suppressed by the Mec1-dependent inhibition of Cdc13 accumulation at DNA breaks.", "journal": "Genes Dev.", "date": "2010", "authors": "Zhang Wei, Durocher Daniel", "evidence": [ { "database": "UniProtKB", "id": "P43615", "url": "https://www.uniprot.org/uniprot/P43615" } ], "reference": [ { "type": "PubMed", "id": "20194442", "url": "https://glygen.org/publication/PubMed/20194442" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P43615", "url": "https://www.uniprot.org/uniprot/P43615" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae.", "journal": "Nat. Genet.", "date": "1995", "authors": "Soeda E., Tashiro H., Yamazaki M., Yokoyama K., Hagiwara H., Murakami Y., Shibata T., Ozawa M., Eki T., Tsuchiya Y., Sasanuma S., Naitou M., Sasanuma M.", "evidence": [ { "database": "UniProtKB", "id": "P43615", "url": "https://www.uniprot.org/uniprot/P43615" } ], "reference": [ { "type": "PubMed", "id": "7670463", "url": "https://glygen.org/publication/PubMed/7670463" } ] }, { "title": "Analysis of a 36.2 kb DNA sequence including the right telomere of chromosome VI from Saccharomyces cerevisiae.", "journal": "Yeast", "date": "1996", "authors": "Hagiwara H., Murakami Y., Shibata T., Hanaoka F., Ozawa M., Eki T., Tsuchiya Y., Sasanuma S., Naitou M., Sasanuma M.", "evidence": [ { "database": "UniProtKB", "id": "P43615", "url": "https://www.uniprot.org/uniprot/P43615" } ], "reference": [ { "type": "PubMed", "id": "8686379", "url": "https://glygen.org/publication/PubMed/8686379" } ] } ], "pathway": [ { "id": "sce:YFR043C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YFR043C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "protein-macromolecule adaptor activity", "id": "GO:0030674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030674", "evidence": [ { "database": "UniProtKB", "id": "P43615", "url": "https://www.uniprot.org/uniprot/P43615" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "vesicle-mediated transport", "id": "GO:0016192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016192", "evidence": [ { "database": "UniProtKB", "id": "P43615", "url": "https://www.uniprot.org/uniprot/P43615" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 218, "end_pos": 220, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }