{ "uniprot_canonical_ac": "P43603-1", "uniprot_ac": "P43603", "uniprot_id": "LSB3_YEAST", "mass": { "chemical_mass": 49344.0, "monoisotopic_mass": 49344.0 }, "refseq": { "ac": "NP_219497", "name": "Lsb3p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_219497" }, "gene_names": [ { "name": "LSB3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P43603", "id": "P43603" }, { "name": "LSB3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_219497", "id": "NP_219497" }, { "name": "YFR024C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_219497", "id": "NP_219497" }, { "name": "YFR024C", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P43603", "id": "P43603" } ], "protein_names": [ { "name": "LAS seventeen-binding protein 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P43603" }, { "name": "LAS17-binding protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P43603" }, { "name": "Lsb3p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_219497", "id": "NP_219497" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "common_name": "Yeast" } ], "gene": [ { "name": "LSB3", "url": "https://www.uniprot.org/uniprot/P43603", "locus": { "chromosome": "VI", "start_pos": 201960, "end_pos": 203433, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "YFR024C-A", "url": "https://www.ensembl.org/id/YFR024C-A" } ] } } ], "crossref": [ { "id": "cd11525", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11525", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11842", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11842", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "850580", "url": "https://www.ncbi.nlm.nih.gov/gene/850580", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P43603", "url": "https://www.ebi.ac.uk/intact/interactors/id:P43603*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007461", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007461", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033643", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033643", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036028", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036028", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YFR024C-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YFR024C-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "P43603", "url": "https://oglcnac.org/atlas/detail/P43603", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P43603", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P43603", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "NDAMYND", "url": "https://omabrowser.org/oma/group/NDAMYND/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "37167at2759", "url": "http://www.orthodb.org/?query=37167at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15629", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15629", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15629:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15629:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1OOT", "url": "https://www.rcsb.org/structure/1OOT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SSH", "url": "https://www.rcsb.org/structure/1SSH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00018", "url": "http://pfam.xfam.org/family/PF00018", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF04366", "url": "http://pfam.xfam.org/family/PF04366", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P43603", "url": "http://purl.obolibrary.org/obo/PR_P43603", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_219497", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_219497", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002968", "url": "https://www.yeastgenome.org/locus/S000002968", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P43603-1", "url": "https://www.uniprot.org/uniprot/P43603-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGINNPIPRSLKSETKKAAKILASFVKPNQVFGADQVIPPDVLKRAKGLAIITILKAGFLFSGRAGSGVIVARLKDGTWSAPSAIAMAGAGAGGMVGIELTDFVFILNTQDAVKSFSEFGTITLGGNVSVSAGPLGRSAEAAASASAGGVAAVFAYSKSKGLFAGVSVEGSAIIERREANRKFYGDNCTAKMILSGRIRPPPAVDPLFRVLESRAFNYRPSNGGRGSFDDDEDDYYDDDDYYNDIPSSFSSTDASSTRPNTRSTRRRAQSGSRYTFDDDDDDDDYGTGYSRNSRLAPTNSGGSGGKLDDPSGASSYYASHRRSGTAQSRARSSRNRWADDEYDDYDDDYESGYRRGNGRDRTKDREVDDLSNRFSKSRISSASTPQTSQGRFTAPTSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV", "length": 459, "header": "sp|P43603-1|LSB3_YEAST Isoform 1 of LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae S288C OX=559292 GN=LSB3 PE=1 SV=3 CANONICAL=P43603-1" }, "isoforms": [ { "isoform_ac": "P43603-1", "url": "", "sequence": { "sequence": "MGINNPIPRSLKSETKKAAKILASFVKPNQVFGADQVIPPDVLKRAKGLAIITILKAGFLFSGRAGSGVIVARLKDGTWSAPSAIAMAGAGAGGMVGIELTDFVFILNTQDAVKSFSEFGTITLGGNVSVSAGPLGRSAEAAASASAGGVAAVFAYSKSKGLFAGVSVEGSAIIERREANRKFYGDNCTAKMILSGRIRPPPAVDPLFRVLESRAFNYRPSNGGRGSFDDDEDDYYDDDDYYNDIPSSFSSTDASSTRPNTRSTRRRAQSGSRYTFDDDDDDDDYGTGYSRNSRLAPTNSGGSGGKLDDPSGASSYYASHRRSGTAQSRARSSRNRWADDEYDDYDDDYESGYRRGNGRDRTKDREVDDLSNRFSKSRISSASTPQTSQGRFTAPTSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV", "length": 459, "header": "sp|P43603-1|LSB3_YEAST Isoform 1 of LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae S288C OX=559292 GN=LSB3 PE=1 SV=3 CANONICAL=P43603-1" }, "locus": { "chromosome": "VI", "start_pos": 203433, "end_pos": 201963, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YFR024C-A_mRNA", "url": "https://www.ensembl.org/id/YFR024C-A_mRNA" }, { "database": "Ensembl Peptide", "id": "YFR024C-A", "url": "https://www.ensembl.org/id/YFR024C-A" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 380, "start_aa": "Ser", "end_pos": 380, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser380", "evidence": [ { "id": "P43603", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P43603" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 381, "start_aa": "Ser", "end_pos": 381, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser381", "evidence": [ { "id": "P43603", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P43603" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 383, "start_aa": "Ser", "end_pos": 383, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser383", "evidence": [ { "id": "P43603", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P43603" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 388, "start_aa": "Ser", "end_pos": 388, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser388", "evidence": [ { "id": "P43603", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P43603" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P43603", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P43603" }, { "id": "33229814", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33229814" } ] } ], "phosphorylation": [ { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "site_lbl": "Ser227" }, { "start_pos": 248, "end_pos": 248, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser248" }, { "start_pos": 251, "end_pos": 251, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser251" }, { "start_pos": 255, "end_pos": 255, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser255" }, { "start_pos": 285, "end_pos": 285, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Tyr285" }, { "start_pos": 298, "end_pos": 298, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" } ], "site_lbl": "Thr298" }, { "start_pos": 300, "end_pos": 300, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "11875433", "url": "https://glygen.org/publication/PubMed/11875433" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser300" }, { "start_pos": 303, "end_pos": 303, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "PubMed", "id": "11875433", "url": "https://glygen.org/publication/PubMed/11875433" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser303" }, { "start_pos": 311, "end_pos": 311, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser311" }, { "start_pos": 315, "end_pos": 315, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser315" }, { "start_pos": 317, "end_pos": 317, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Tyr317" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser375" }, { "start_pos": 377, "end_pos": 377, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser377" }, { "start_pos": 380, "end_pos": 380, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser380" }, { "start_pos": 381, "end_pos": 381, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser381" }, { "start_pos": 383, "end_pos": 383, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser383" }, { "start_pos": 384, "end_pos": 384, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr384" }, { "start_pos": 387, "end_pos": 387, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr387" }, { "start_pos": 388, "end_pos": 388, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser388" }, { "start_pos": 393, "end_pos": 393, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr393" }, { "start_pos": 396, "end_pos": 396, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" } ], "site_lbl": "Thr396" }, { "start_pos": 397, "end_pos": 397, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser397" }, { "start_pos": 400, "end_pos": 400, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" } ], "site_lbl": "Thr400" }, { "start_pos": 402, "end_pos": 402, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P43603", "url": "https://www.yeastgenome.org/locus/P43603" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser402" }, { "start_pos": 416, "end_pos": 416, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "site_lbl": "Ser416" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The Saccharomyces cerevisiae homologue of human Wiskott-Aldrich syndrome protein Las17p interacts with the Arp2/3 complex.", "journal": "Mol. Biol. Cell", "date": "1999", "authors": "Winsor B., Moreau V., Dumoulin P., Grava S., Kitamoto H., Madania A., Scharer-Brodbeck C., Soulard A.", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "reference": [ { "type": "PubMed", "id": "10512884", "url": "https://glygen.org/publication/PubMed/10512884" } ] }, { "title": "Test of intron predictions reveals novel splice sites, alternatively spliced mRNAs and new introns in meiotically regulated genes of yeast.", "journal": "Nucleic Acids Res.", "date": "2000", "authors": "Ares M. Jr., Davis C.A., Spingola M., Grate L.", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "reference": [ { "type": "PubMed", "id": "10734188", "url": "https://glygen.org/publication/PubMed/10734188" } ] }, { "title": "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae.", "journal": "Nature biotechnology", "date": "2002-03", "authors": "Ficarro Scott B, McCleland Mark L, Stukenberg P Todd, Burke Daniel J, Ross Mark M, Shabanowitz Jeffrey, Hunt Donald F, White Forest M", "evidence": [ { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "reference": [ { "type": "PubMed", "id": "11875433", "url": "https://glygen.org/publication/PubMed/11875433" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway.", "journal": "Molecular & cellular proteomics : MCP", "date": "2005-03", "authors": "Gruhler Albrecht, Olsen Jesper V, Mohammed Shabaz, Mortensen Peter, Faergeman Nils J, Mann Matthias, Jensen Ole N", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "reference": [ { "type": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "Journal of proteome research", "date": "2007-03", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Characterization of the rapamycin-sensitive phosphoproteome reveals that Sch9 is a central coordinator of protein synthesis.", "journal": "Genes & development", "date": "2009-08-15", "authors": "Huber Alexandre, Bodenmiller Bernd, Uotila Aino, Stahl Michael, Wanka Stefanie, Gerrits Bertran, Aebersold Ruedi, Loewith Robbie", "evidence": [ { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "reference": [ { "type": "PubMed", "id": "19684113", "url": "https://glygen.org/publication/PubMed/19684113" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" }, { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "The rapamycin-sensitive phosphoproteome reveals that TOR controls protein kinase A toward some but not all substrates.", "journal": "Molecular biology of the cell", "date": "2010-10-01", "authors": "Soulard Alexandre, Cremonesi Alessio, Moes Suzette, Sch\u00fctz Fr\u00e9d\u00e9ric, Jen\u00f6 Paul, Hall Michael N", "evidence": [ { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "reference": [ { "type": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P43603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43603" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Identification of novel O-GlcNAc transferase substrates using yeast cells expressing OGT.", "journal": "The Journal of general and applied microbiology", "date": "2021-04-16", "authors": "Li Feng, Yang Ganglong, Tachikawa Hiroyuki, Shao Kankai, Yang Yan, Gao Xiao-Dong, Nakanishi Hideki", "evidence": [ { "database": "O-GlcNAc Database", "id": "P43603", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P43603" }, { "database": "O-GlcNAc Atlas", "id": "P43603", "url": "https://oglcnac.org/atlas/detail/P43603" } ], "reference": [ { "type": "PubMed", "id": "33229814", "url": "https://glygen.org/publication/PubMed/33229814" } ] }, { "title": "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae.", "journal": "Nat. Genet.", "date": "1995", "authors": "Soeda E., Tashiro H., Yamazaki M., Yokoyama K., Hagiwara H., Murakami Y., Shibata T., Ozawa M., Eki T., Tsuchiya Y., Sasanuma S., Naitou M., Sasanuma M.", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "reference": [ { "type": "PubMed", "id": "7670463", "url": "https://glygen.org/publication/PubMed/7670463" } ] } ], "pathway": [ { "id": "sce:YFR024C-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YFR024C-A", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O08641-1", "protein_name": "SH3 domain-containing YSC84-like protein 1", "gene_name": "Sh3yl1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAVLSVIKAGFLVTARGGSGIVLARLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNFTVAVGPLGRNLEGNVSLRSSAAVFTYCKSRGLFAGISLEGSCLIERKETNRKFYCQDIRAYDILFGDVPQPAQAEDLYEILNSFTEKYETEGQRINLKKVAREQRKAKELPPKPSSRPQPAHPPVQLNAGSQGNRNEYKLYPELSSYHEKTGNLNQPIEVTALYSFEGQQPGDLNFQAGDRIIVISKTDSNFDWWEGKLRGQTGIFPANYVTMN", "length": 340 }, "evidence": [ { "id": "P43603", "url": "https://omabrowser.org/oma/group/P43603/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q96HL8-1", "protein_name": "SH3 domain-containing YSC84-like protein 1", "gene_name": "SH3YL1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVVARLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNLTVAVGPLGRNLEGNVALRSSAAVFTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEGQRINARKAAREQRKSSAKELPPKPLSRPQQSSAPVQLNSGSQSNRNEYKLYPGLSSYHERVGNLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYVTMN", "length": 342 }, "evidence": [ { "id": "P43603", "url": "https://omabrowser.org/oma/group/P43603/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "pmid": "" }, { "name": "actin cortical patch", "id": "GO:0030479", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030479", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "pmid": "" }, { "name": "cellular bud neck", "id": "GO:0005935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005935", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "pmid": "" }, { "name": "actin filament binding", "id": "GO:0051015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051015", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "pmid": "" }, { "name": "phosphatidylinositol binding", "id": "GO:0035091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035091", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "actin filament bundle assembly", "id": "GO:0051017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051017", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "pmid": "" }, { "name": "actin cortical patch localization", "id": "GO:0051666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051666", "evidence": [ { "database": "UniProtKB", "id": "P43603", "url": "https://www.uniprot.org/uniprot/P43603" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 127, "end_pos": 129, "annotation": "n_glycosylation_sequon" }, { "start_pos": 187, "end_pos": 189, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 5 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 5 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 25 }, { "field": "total_sites", "count": 25 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }