{ "uniprot_canonical_ac": "P42866-1", "uniprot_ac": "P42866", "uniprot_id": "OPRM_MOUSE", "mass": { "chemical_mass": 44421.0, "monoisotopic_mass": 44421.0 }, "refseq": { "ac": "XP_017169315", "name": "mu-type opioid receptor isoform X2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017169315" }, "gene_names": [ { "name": "Oprm1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P42866", "id": "P42866" }, { "name": "M-OR-1; MOP-R; mor; MOR-1; MOR-1O; muOR; Oprm", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017169317", "id": "XP_017169317" }, { "name": "Mor", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P42866", "id": "P42866" }, { "name": "Oprm1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017169317", "id": "XP_017169317" }, { "name": "Oprm", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P42866", "id": "P42866" } ], "protein_names": [ { "name": "Mu-type opioid receptor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P42866" }, { "name": "M-OR-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P42866" }, { "name": "MOR-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P42866" }, { "name": "mu-type opioid receptor isoform MOR-1C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034741", "id": "NP_001034741" }, { "name": "mu-type opioid receptor isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017169315", "id": "XP_017169315" }, { "name": "mu-type opioid receptor isoform X4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017169317", "id": "XP_017169317" }, { "name": "mu-type opioid receptor; MOP receptor; mu opioid receptor MOR-1P; mu opioid receptor MOR-1BI", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034741", "id": "NP_001034741" } ], "function": [ { "annotation": "Human OPRM1 and murine Oprm1 promoter driven viral constructs for genetic access to mu-opioidergic cell types. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001034741", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034741" }, { "database": "PubMed", "id": "37704594", "url": "https://glygen.org/publication/PubMed/37704594" } ] }, { "annotation": "Isoform 9 is involved in morphine-induced scratching and seems to cross-activate GRPR in response to morphine.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866#function" }, { "database": "PubMed", "id": "22000021", "url": "https://glygen.org/publication/PubMed/22000021" } ] }, { "annotation": "Receptor for endogenous opioids such as beta-endorphin and endomorphin (PubMed:21422164, PubMed:22437502, PubMed:10842167, PubMed:16682964, PubMed:26245379, PubMed:7797593, PubMed:9037090). Receptor for natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphin and methadone (PubMed:16682964, PubMed:7797593, PubMed:9037090). Also activated by enkephalin peptides, such as Met-enkephalin or Met-enkephalin-Arg-Phe, with higher affinity for Met-enkephalin-Arg-Phe (PubMed:6933569, PubMed:35201898). Agonist binding to the receptor induces coupling to an inactive GDP-bound heterotrimeric G-protein complex and subsequent exchange of GDP for GTP in the G-protein alpha subunit leading to dissociation of the G-protein complex with the free GTP-bound G-protein alpha and the G-protein beta-gamma dimer activating downstream cellular effectors (PubMed:10842167, PubMed:21422164, PubMed:22437502). The agonist- and cell type-specific activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins, GNAI1, GNAI2, GNAI3 and GNAO1 isoforms Alpha-1 and Alpha-2, and to a lesser extent to pertussis toxin-insensitive G alpha proteins GNAZ and GNA15 (PubMed:9767386, PubMed:26245379). They mediate an array of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K) and regulation of NF-kappa-B (By similarity). Also couples to adenylate cyclase stimulatory G alpha proteins (By similarity). The selective temporal coupling to G-proteins and subsequent signaling can be regulated by RGSZ proteins, such as RGS9, RGS17 and RGS4 (PubMed:15827571, PubMed:17725581). Phosphorylation by members of the GPRK subfamily of Ser/Thr protein kinases and association with beta-arrestins is involved in short-term receptor desensitization (By similarity). Beta-arrestins associate with the GPRK-phosphorylated receptor and uncouple it from the G-protein thus terminating signal transduction (By similarity). The phosphorylated receptor is internalized through endocytosis via clathrin-coated pits which involves beta-arrestins (PubMed:12642578). The activation of the ERK pathway occurs either in a G-protein-dependent or a beta-arrestin-dependent manner and is regulated by agonist-specific receptor phosphorylation (By similarity). Acts as a class A G-protein coupled receptor (GPCR) which dissociates from beta-arrestin at or near the plasma membrane and undergoes rapid recycling (By similarity). Receptor down-regulation pathways are varying with the agonist and occur dependent or independent of G-protein coupling. Endogenous ligands induce rapid desensitization, endocytosis and recycling (By similarity). Heterooligomerization with other GPCRs can modulate agonist binding, signaling and trafficking properties (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866#function" }, { "database": "PubMed", "id": "21422164", "url": "https://glygen.org/publication/PubMed/21422164" }, { "database": "PubMed", "id": "26245379", "url": "https://glygen.org/publication/PubMed/26245379" }, { "database": "PubMed", "id": "7797593", "url": "https://glygen.org/publication/PubMed/7797593" }, { "database": "PubMed", "id": "22437502", "url": "https://glygen.org/publication/PubMed/22437502" }, { "database": "UniProtKB", "id": "P33535", "url": "https://www.uniprot.org/uniprot/P33535#function" }, { "database": "PubMed", "id": "16682964", "url": "https://glygen.org/publication/PubMed/16682964" }, { "database": "PubMed", "id": "9037090", "url": "https://glygen.org/publication/PubMed/9037090" }, { "database": "PubMed", "id": "15827571", "url": "https://glygen.org/publication/PubMed/15827571" }, { "database": "PubMed", "id": "17725581", "url": "https://glygen.org/publication/PubMed/17725581" }, { "database": "PubMed", "id": "6933569", "url": "https://glygen.org/publication/PubMed/6933569" }, { "database": "PubMed", "id": "35201898", "url": "https://glygen.org/publication/PubMed/35201898" }, { "database": "PubMed", "id": "9767386", "url": "https://glygen.org/publication/PubMed/9767386" }, { "database": "PubMed", "id": "12642578", "url": "https://glygen.org/publication/PubMed/12642578" }, { "database": "PubMed", "id": "10842167", "url": "https://glygen.org/publication/PubMed/10842167" } ] }, { "annotation": "This gene encodes the mu opioid receptor which is where drugs such as morphine and other opioids have pharmacological effects. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_001034741", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034741" } ] }, { "annotation": "Upstream open reading frames in mouse MOR mRNA act as negative regulators of translation through a ribosome leaky scanning mechanism.", "evidence": [ { "database": "RefSeq", "id": "NP_001034741", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034741" }, { "database": "PubMed", "id": "17284463", "url": "https://glygen.org/publication/PubMed/17284463" } ] } ], "disease": [ { "disease_id": "DOID:0060041", "recommended_name": { "id": "DOID:0060041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060041", "name": "autism spectrum disorder", "description": "A pervasive developmental disorder that is a spectrum of psychological conditions. The disease has_symptom widespread abnormalities of social interactions and communication, has_symptom severely restricted interests and has_symptom highly repetitive behavior." }, "synonyms": [], "evidence": [ { "id": "0060041", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060041" } ] }, { "disease_id": "DOID:14330", "recommended_name": { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson's disease", "description": "A synucleinopathy that has_material_basis_in degeneration of the central nervous system that often impairs motor skills, speech, and other functions." }, "synonyms": [ { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson disease", "description": "" }, { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "paralysis agitans", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "A Parkinson disease that begins after around the age of 50." }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "LOPD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PARK", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, age of onset, modifier, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "autosomal dominant late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson's disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "" }, { "id": "MIM:168600", "resource": "MIM", "url": "https://www.omim.org/entry/168600", "name": "Parkinson disease", "description": "Parkinson disease" } ], "evidence": [ { "id": "14330", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14330" } ] }, { "disease_id": "DOID:2316", "recommended_name": { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "brain ischemia", "description": "An ischemia that is characterized by insufficient blood flow to the brain to meet metabolic demand." }, "synonyms": [ { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "Ischaemic encephalopathy", "description": "" }, { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "Ischemic encephalopathy", "description": "" }, { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "cerebral ischemia", "description": "" } ], "evidence": [ { "id": "2316", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2316" } ] }, { "disease_id": "DOID:526", "recommended_name": { "id": "DOID:526", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:526", "name": "human immunodeficiency virus infectious disease", "description": "A viral infectious disease that results in destruction of immune system, leading to life-threatening opportunistic infections and cancers, has_material_basis_in Human immunodeficiency virus 1 or has_material_basis_in Human immunodeficiency virus 2, which are transmitted by sexual contact, transmitted by transfer of blood, semen, vaginal fluid, pre-ejaculate, or breast milk, transmitted by congenital method, and transmitted by contaminated needles. The virus infects helper T cells (CD4+ T cells) which are directly or indirectly destroyed, macrophages, and dendritic cells. The infection has symptom diarrhea, has symptom fatigue, has symptom fever, has symptom vaginal yeast infection, has symptom headache, has symptom mouth sores, has symptom muscle aches, has symptom sore throat, and has symptom swollen lymph glands." }, "synonyms": [ { "id": "DOID:526", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:526", "name": "HIV infection", "description": "" } ], "evidence": [ { "id": "526", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:526" } ] } ], "snv": [ { "evidence": [ { "id": "rs3389089285", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389089285" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 344, "end_pos": 344, "sequence_org": "K", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NFK->NFT).", "chr_id": "10", "chr_pos": "6780370", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K344", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3389084382", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389084382" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 48, "end_pos": 48, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRM).", "chr_id": "10", "chr_pos": "6739017", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T48", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 387, "end_pos": 387, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes receptor recycling; when associated with A-390.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" }, { "database": "PubMed", "id": "12939277", "url": "https://glygen.org/publication/PubMed/12939277" } ] }, { "start_pos": 390, "end_pos": 390, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes receptor recycling; when associated with A-387.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" }, { "database": "PubMed", "id": "12939277", "url": "https://glygen.org/publication/PubMed/12939277" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Oprm1", "url": "https://www.uniprot.org/uniprot/P42866", "locus": { "chromosome": "10", "start_pos": 6988198, "end_pos": 6708506, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000000766", "url": "https://www.ensembl.org/id/ENSMUSG00000000766" } ] } } ], "crossref": [ { "id": "ENSMUSG00000000766", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000000766", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15090", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15090", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2858", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2858", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "18390", "url": "https://www.ncbi.nlm.nih.gov/gene/18390", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P42866", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42866*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000105", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000105", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001418", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001418", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:18390", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18390", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "97441", "url": "http://www.informatics.jax.org/marker/MGI:97441", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P42866", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P42866", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CGNFTDN", "url": "https://omabrowser.org/oma/group/CGNFTDN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5393360at2759", "url": "http://www.orthodb.org/?query=5393360at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24229", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24229", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24229:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24229:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4DKL", "url": "https://www.rcsb.org/structure/4DKL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C1M", "url": "https://www.rcsb.org/structure/5C1M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6DDE", "url": "https://www.rcsb.org/structure/6DDE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6DDF", "url": "https://www.rcsb.org/structure/6DDF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SBF", "url": "https://www.rcsb.org/structure/7SBF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SCG", "url": "https://www.rcsb.org/structure/7SCG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7T2G", "url": "https://www.rcsb.org/structure/7T2G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7T2H", "url": "https://www.rcsb.org/structure/7T2H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7U2K", "url": "https://www.rcsb.org/structure/7U2K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7U2L", "url": "https://www.rcsb.org/structure/7U2L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UL4", "url": "https://www.rcsb.org/structure/7UL4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P42866", "url": "http://purl.obolibrary.org/obo/PR_P42866", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-111885", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-111885", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-202040", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-375276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001034741", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034741", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4J0Z2", "url": "https://www.uniprot.org/uniprot/A0A0R4J0Z2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4J0Z2-1", "url": "https://www.uniprot.org/uniprot/A0A0R4J0Z2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1KZZ4", "url": "https://www.uniprot.org/uniprot/A1KZZ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1KZZ4-1", "url": "https://www.uniprot.org/uniprot/A1KZZ4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PVC1", "url": "https://www.uniprot.org/uniprot/E9PVC1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PVC1-1", "url": "https://www.uniprot.org/uniprot/E9PVC1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q270", "url": "https://www.uniprot.org/uniprot/E9Q270", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q270-1", "url": "https://www.uniprot.org/uniprot/E9Q270-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q2X5", "url": "https://www.uniprot.org/uniprot/E9Q2X5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q2X5-1", "url": "https://www.uniprot.org/uniprot/E9Q2X5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q7D3", "url": "https://www.uniprot.org/uniprot/E9Q7D3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q7D3-1", "url": "https://www.uniprot.org/uniprot/E9Q7D3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q7D4", "url": "https://www.uniprot.org/uniprot/E9Q7D4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q7D4-1", "url": "https://www.uniprot.org/uniprot/E9Q7D4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9QAQ1", "url": "https://www.uniprot.org/uniprot/E9QAQ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9QAQ1-1", "url": "https://www.uniprot.org/uniprot/E9QAQ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-1", "url": "https://www.uniprot.org/uniprot/P42866-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-10", "url": "https://www.uniprot.org/uniprot/P42866-10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-11", "url": "https://www.uniprot.org/uniprot/P42866-11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-12", "url": "https://www.uniprot.org/uniprot/P42866-12", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-13", "url": "https://www.uniprot.org/uniprot/P42866-13", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-14", "url": "https://www.uniprot.org/uniprot/P42866-14", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-15", "url": "https://www.uniprot.org/uniprot/P42866-15", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-16", "url": "https://www.uniprot.org/uniprot/P42866-16", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-17", "url": "https://www.uniprot.org/uniprot/P42866-17", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-18", "url": "https://www.uniprot.org/uniprot/P42866-18", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-19", "url": "https://www.uniprot.org/uniprot/P42866-19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-2", "url": "https://www.uniprot.org/uniprot/P42866-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-3", "url": "https://www.uniprot.org/uniprot/P42866-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-4", "url": "https://www.uniprot.org/uniprot/P42866-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-5", "url": "https://www.uniprot.org/uniprot/P42866-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-6", "url": "https://www.uniprot.org/uniprot/P42866-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-7", "url": "https://www.uniprot.org/uniprot/P42866-7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-8", "url": "https://www.uniprot.org/uniprot/P42866-8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42866-9", "url": "https://www.uniprot.org/uniprot/P42866-9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4U2P0", "url": "https://www.uniprot.org/uniprot/Q4U2P0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4U2P0-1", "url": "https://www.uniprot.org/uniprot/Q4U2P0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4U2P1", "url": "https://www.uniprot.org/uniprot/Q4U2P1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4U2P1-1", "url": "https://www.uniprot.org/uniprot/Q4U2P1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4U2P9", "url": "https://www.uniprot.org/uniprot/Q4U2P9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4U2P9-1", "url": "https://www.uniprot.org/uniprot/Q4U2P9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQLENLEAETAPLP", "length": 398, "header": "sp|P42866-1|OPRM_MOUSE Isoform 1 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "isoforms": [ { "isoform_ac": "A0A0R4J0Z2-1", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQIMKFEAIYPKLSFKSWALKYFTFIREKKRNTKAGALPPLPTCHAGSPSQAHRGVAAWLLPLRHMGPSYPS", "length": 456, "header": "tr|A0A0R4J0Z2-1|A0A0R4J0Z2_MOUSE Computationally mapped isoform of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6782726, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000078634.12", "url": "https://www.ensembl.org/id/ENSMUST00000078634.12" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000077704.6", "url": "https://www.ensembl.org/id/ENSMUSP00000077704.6" } ] } }, { "isoform_ac": "A1KZZ4-1", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRVHRLHPHVLSSHMVLGEPAQNLCLHLRLHHAGPHHHCVLWTDDLTTQECPHAVGLQRKGQEPAQDHPDGAGGRGCIYCLLDPHPHLCHHQSTDHDSRNHFPDCFLALLHCLGLHKQLPEPSSLCVPG", "length": 222, "header": "tr|A1KZZ4-1|A1KZZ4_MOUSE Computationally mapped isoform of Mu opioid receptor mMOR-1R1 OS=Mus musculus OX=10090 GN=Oprm1 PE=2 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6780358, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105601.9", "url": "https://www.ensembl.org/id/ENSMUST00000105601.9" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101226.3", "url": "https://www.ensembl.org/id/ENSMUSP00000101226.3" } ] } }, { "isoform_ac": "E9PVC1-1", "url": "", "sequence": { "sequence": "MVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQKQEKTKTKSAWEIWEQKEHTLLLGETHLTIQHLS", "length": 356, "header": "tr|E9PVC1-1|OPRM_MOUSE Computationally mapped isoform of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6883068, "end_pos": 6739067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000129221.8", "url": "https://www.ensembl.org/id/ENSMUST00000129221.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000123117.2", "url": "https://www.ensembl.org/id/ENSMUSP00000123117.2" } ] } }, { "isoform_ac": "E9Q270-1", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVSMQLPILTVG", "length": 104, "header": "tr|E9Q270-1|OPRM_MOUSE Computationally mapped isoform of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6744258, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000152674.2", "url": "https://www.ensembl.org/id/ENSMUST00000152674.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000115552.2", "url": "https://www.ensembl.org/id/ENSMUSP00000115552.2" } ] } }, { "isoform_ac": "E9Q2X5-1", "url": "", "sequence": { "sequence": "MVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQKKKLDSQRGCVQHPV", "length": 337, "header": "tr|E9Q2X5-1|OPRM_MOUSE Computationally mapped isoform of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6922243, "end_pos": 6739067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000154941.8", "url": "https://www.ensembl.org/id/ENSMUST00000154941.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000115413.2", "url": "https://www.ensembl.org/id/ENSMUSP00000115413.2" } ] } }, { "isoform_ac": "E9Q7D3-1", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQEPQSAET", "length": 393, "header": "tr|E9Q7D3-1|OPRM_MOUSE Computationally mapped isoform of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6789555, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105604.8", "url": "https://www.ensembl.org/id/ENSMUST00000105604.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101229.2", "url": "https://www.ensembl.org/id/ENSMUSP00000101229.2" } ] } }, { "isoform_ac": "E9Q7D4-1", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQWQG", "length": 389, "header": "tr|E9Q7D4-1|OPRM_MOUSE Computationally mapped isoform of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6781945, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105603.2", "url": "https://www.ensembl.org/id/ENSMUST00000105603.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101228.2", "url": "https://www.ensembl.org/id/ENSMUSP00000101228.2" } ] } }, { "isoform_ac": "E9QAQ1-1", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQAPCACMPGANRGQTKASDLLDLELKTVGSHQADAETNPGPYEGSKCAEPLSHLSGPSTLALC", "length": 448, "header": "tr|E9QAQ1-1|OPRM_MOUSE Computationally mapped isoform of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6858061, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000129954.8", "url": "https://www.ensembl.org/id/ENSMUST00000129954.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000122385.2", "url": "https://www.ensembl.org/id/ENSMUSP00000122385.2" } ] } }, { "isoform_ac": "P42866-1", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQLENLEAETAPLP", "length": 398, "header": "sp|P42866-1|OPRM_MOUSE Isoform 1 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6799841, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105607", "url": "https://www.ensembl.org/id/ENSMUST00000105607" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101232", "url": "https://www.ensembl.org/id/ENSMUSP00000101232" } ] } }, { "isoform_ac": "P42866-10", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQKKKLDSQRGCVQHPV", "length": 401, "header": "sp|P42866-10|OPRM_MOUSE Isoform 10 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": {} }, { "isoform_ac": "P42866-11", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQAPCACVPGANRGQTKASDLLDLELETVGSHQADAETNPGPYEGSKCAEPLAISLVPLY", "length": 444, "header": "sp|P42866-11|OPRM_MOUSE Isoform 11 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": {} }, { "isoform_ac": "P42866-12", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQPTLAVSVAQIFTGYPSPTHVEKPCKSCMDR", "length": 416, "header": "sp|P42866-12|OPRM_MOUSE Isoform 12 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6929705, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000135502", "url": "https://www.ensembl.org/id/ENSMUST00000135502" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000135143", "url": "https://www.ensembl.org/id/ENSMUSP00000135143" } ] } }, { "isoform_ac": "P42866-13", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQIMKFEAIYPKLSFKSWALKYFTFIREKKRNTKAGALPTCHAGSPSQAHRGVAAWLLPLRHMGPSYPS", "length": 453, "header": "sp|P42866-13|OPRM_MOUSE Isoform 13 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": {} }, { "isoform_ac": "P42866-14", "url": "", "sequence": { "sequence": "MMEAFSKSAFQKLRQRDGNQEGKSYLRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQLENLEAETAPLP", "length": 330, "header": "sp|P42866-14|OPRM_MOUSE Isoform 14 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6799841, "end_pos": 6708611, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000147171", "url": "https://www.ensembl.org/id/ENSMUST00000147171" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000117950", "url": "https://www.ensembl.org/id/ENSMUSP00000117950" } ] } }, { "isoform_ac": "P42866-15", "url": "", "sequence": { "sequence": "MMEAFSKSAFQKLRQRDGNQEGKSYLRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQPTLAVSVAQIFTGYPSPTHVEKPCKSCMDRGMRNLLPDDGPRQESGEGQLGR", "length": 370, "header": "sp|P42866-15|OPRM_MOUSE Isoform 15 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6987158, "end_pos": 6708611, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105615", "url": "https://www.ensembl.org/id/ENSMUST00000105615" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101240", "url": "https://www.ensembl.org/id/ENSMUSP00000101240" } ] } }, { "isoform_ac": "P42866-16", "url": "", "sequence": { "sequence": "MMEAFSKSAFQKLRQRDGNQEGKSYLRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQRNEEPSS", "length": 325, "header": "sp|P42866-16|OPRM_MOUSE Isoform 16 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6964061, "end_pos": 6708611, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000063036", "url": "https://www.ensembl.org/id/ENSMUST00000063036" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000053498", "url": "https://www.ensembl.org/id/ENSMUSP00000053498" } ] } }, { "isoform_ac": "P42866-17", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQPTLAVSVAQIFTGYPSPTHVEKPCKSCMDSVDCYNRKQQTGSLRKNKKKKKRRKNKQNILEAGISRGMRNLLPDDGPRQESGEGQLGR", "length": 474, "header": "sp|P42866-17|OPRM_MOUSE Isoform 17 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": {} }, { "isoform_ac": "P42866-18", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQKQEKTKTKSAWEIWEQKEHTLLLGETHLTIQHLS", "length": 420, "header": "sp|P42866-18|OPRM_MOUSE Isoform 18 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": {} }, { "isoform_ac": "P42866-19", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQLAFGCCNEHHDQR", "length": 399, "header": "sp|P42866-19|OPRM_MOUSE Isoform 19 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6883110, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000144264", "url": "https://www.ensembl.org/id/ENSMUST00000144264" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000115836", "url": "https://www.ensembl.org/id/ENSMUSP00000115836" } ] } }, { "isoform_ac": "P42866-2", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQVCAF", "length": 390, "header": "sp|P42866-2|OPRM_MOUSE Isoform 2 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6780509, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105602", "url": "https://www.ensembl.org/id/ENSMUST00000105602" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101227", "url": "https://www.ensembl.org/id/ENSMUSP00000101227" } ] } }, { "isoform_ac": "P42866-3", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQKIDLF", "length": 391, "header": "sp|P42866-3|OPRM_MOUSE Isoform 3 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6791273, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105605", "url": "https://www.ensembl.org/id/ENSMUST00000105605" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101230", "url": "https://www.ensembl.org/id/ENSMUSP00000101230" } ] } }, { "isoform_ac": "P42866-4", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQKLLMWRAMPTFKRHLAIMLSLDN", "length": 409, "header": "sp|P42866-4|OPRM_MOUSE Isoform 4 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6790634, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000154906", "url": "https://www.ensembl.org/id/ENSMUST00000154906" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114342", "url": "https://www.ensembl.org/id/ENSMUSP00000114342" } ] } }, { "isoform_ac": "P42866-5", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQTSLTLQ", "length": 392, "header": "sp|P42866-5|OPRM_MOUSE Isoform 5 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6789829, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000092731", "url": "https://www.ensembl.org/id/ENSMUST00000092731" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000090407", "url": "https://www.ensembl.org/id/ENSMUSP00000090407" } ] } }, { "isoform_ac": "P42866-6", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQAHQKPQECLKCRCLSLTILVICLHFQHQQFFIMIKKNVS", "length": 425, "header": "sp|P42866-6|OPRM_MOUSE Isoform 6 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6788521, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000000783", "url": "https://www.ensembl.org/id/ENSMUST00000000783" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000000783", "url": "https://www.ensembl.org/id/ENSMUSP00000000783" } ] } }, { "isoform_ac": "P42866-7", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQCV", "length": 388, "header": "sp|P42866-7|OPRM_MOUSE Isoform 7 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6788048, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000092729", "url": "https://www.ensembl.org/id/ENSMUST00000092729" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000090405", "url": "https://www.ensembl.org/id/ENSMUSP00000090405" } ] } }, { "isoform_ac": "P42866-8", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQPTLAVSVAQIFTGYPSPTHVEKPCKSCMDRGMRNLLPDDGPRQESGEGQLGR", "length": 438, "header": "sp|P42866-8|OPRM_MOUSE Isoform 8 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6987158, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105611", "url": "https://www.ensembl.org/id/ENSMUST00000105611" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101236", "url": "https://www.ensembl.org/id/ENSMUSP00000101236" } ] } }, { "isoform_ac": "P42866-9", "url": "", "sequence": { "sequence": "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQRNEEPSS", "length": 393, "header": "sp|P42866-9|OPRM_MOUSE Isoform 9 of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6964061, "end_pos": 6738875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000052751", "url": "https://www.ensembl.org/id/ENSMUST00000052751" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000060329", "url": "https://www.ensembl.org/id/ENSMUSP00000060329" } ] } }, { "isoform_ac": "Q4U2P0-1", "url": "", "sequence": { "sequence": "MMEAFSKSAFQKLRQRDGNQEGKSYLRLPLSILFLNKES", "length": 39, "header": "tr|Q4U2P0-1|OPRM_MOUSE Computationally mapped isoform of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6773842, "end_pos": 6708611, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105597.8", "url": "https://www.ensembl.org/id/ENSMUST00000105597.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101222.2", "url": "https://www.ensembl.org/id/ENSMUSP00000101222.2" } ] } }, { "isoform_ac": "Q4U2P1-1", "url": "", "sequence": { "sequence": "MMEAFSKSAFQKLRQRDGNQEGKSYLRHLIPRKEIIFLKLK", "length": 41, "header": "tr|Q4U2P1-1|OPRM_MOUSE Computationally mapped isoform of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6775157, "end_pos": 6708611, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000150374.8", "url": "https://www.ensembl.org/id/ENSMUST00000150374.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114856.2", "url": "https://www.ensembl.org/id/ENSMUSP00000114856.2" } ] } }, { "isoform_ac": "Q4U2P9-1", "url": "", "sequence": { "sequence": "MMEAFSKSAFQKLRQRDGNQEGKSYLRACPCKKLTEPRAAVRGRGWGAWNPNTLECSQLQPTESAASIQNHGQQRRPREHQRLL", "length": 84, "header": "tr|Q4U2P9-1|OPRM_MOUSE Computationally mapped isoform of Mu-type opioid receptor OS=Mus musculus OX=10090 GN=Oprm1 PE=1 SV=1 CANONICAL=P42866-1" }, "locus": { "chromosome": "10", "start_pos": 6738915, "end_pos": 6708611, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000143875.2", "url": "https://www.ensembl.org/id/ENSMUST00000143875.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000123617.2", "url": "https://www.ensembl.org/id/ENSMUSP00000123617.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 31, "start_aa": "Asn", "end_pos": 31, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn31", "evidence": [ { "id": "P42866", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42866#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 38, "start_aa": "Asn", "end_pos": 38, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn38", "evidence": [ { "id": "P42866", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42866#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 46, "start_aa": "Asn", "end_pos": 46, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn46", "evidence": [ { "id": "P42866", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42866#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 9, "start_aa": "Asn", "end_pos": 9, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn9", "evidence": [ { "id": "P42866", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42866#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P42866", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P42866" }, { "id": "22645316", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22645316" } ] } ], "phosphorylation": [ { "start_pos": 166, "end_pos": 166, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "site_lbl": "Tyr166" }, { "start_pos": 180, "end_pos": 180, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" }, { "database": "PubMed", "id": "14978231", "url": "https://glygen.org/publication/PubMed/14978231" } ], "site_lbl": "Thr180" }, { "start_pos": 336, "end_pos": 336, "kinase_uniprot_canonical_ac": "P05480-2", "kinase_gene_name": "Src", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" }, { "database": "PubMed", "id": "19029294", "url": "https://glygen.org/publication/PubMed/19029294" } ], "site_lbl": "Tyr336" }, { "start_pos": 336, "end_pos": 336, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" }, { "database": "PubMed", "id": "28818835", "url": "https://glygen.org/publication/PubMed/28818835" } ], "site_lbl": "Tyr336" }, { "start_pos": 363, "end_pos": 363, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" }, { "database": "PubMed", "id": "25801029", "url": "https://glygen.org/publication/PubMed/25801029" }, { "database": "PubMed", "id": "26226422", "url": "https://glygen.org/publication/PubMed/26226422" } ], "site_lbl": "Ser363" }, { "start_pos": 370, "end_pos": 370, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" }, { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" }, { "database": "PubMed", "id": "25801029", "url": "https://glygen.org/publication/PubMed/25801029" }, { "database": "PubMed", "id": "26226422", "url": "https://glygen.org/publication/PubMed/26226422" } ], "site_lbl": "Thr370" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" }, { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" }, { "database": "PubMed", "id": "17825524", "url": "https://glygen.org/publication/PubMed/17825524" }, { "database": "PubMed", "id": "24629717", "url": "https://glygen.org/publication/PubMed/24629717" }, { "database": "PubMed", "id": "25801029", "url": "https://glygen.org/publication/PubMed/25801029" }, { "database": "PubMed", "id": "26013542", "url": "https://glygen.org/publication/PubMed/26013542" }, { "database": "PubMed", "id": "26226422", "url": "https://glygen.org/publication/PubMed/26226422" }, { "database": "PubMed", "id": "30787373", "url": "https://glygen.org/publication/PubMed/30787373" } ], "site_lbl": "Ser375" }, { "start_pos": 394, "end_pos": 394, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" }, { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" }, { "database": "PubMed", "id": "27707973", "url": "https://glygen.org/publication/PubMed/27707973" } ], "site_lbl": "Thr394" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Identification and characterization of three new alternatively spliced mu-opioid receptor isoforms.", "journal": "Mol. Pharmacol.", "date": "1999", "authors": "Rossi G., Xu J., Chang A., Abbadie C., Pan Y.X., Pasternak G.W., Bolan E., Zuckerman A.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "10419560", "url": "https://glygen.org/publication/PubMed/10419560" } ] }, { "title": "Isolation and expression of a novel alternatively spliced mu opioid receptor isoform, MOR-1F.", "journal": "FEBS Lett.", "date": "2000", "authors": "Rossi G., Xu J., Chang A., Mahurter L., Pan Y.X., Pasternak G.W., Bolan E.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "10682855", "url": "https://glygen.org/publication/PubMed/10682855" } ] }, { "title": "Oligomerization of mu- and delta-opioid receptors. Generation of novel functional properties.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Xie Z., George S.R., O'Dowd B.F., Fan T., Tse R., Varghese G., Tam V.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "10842167", "url": "https://glygen.org/publication/PubMed/10842167" } ] }, { "title": "The untranslated region of (mu)-opioid receptor mRNA contributes to reduced opioid sensitivity in CXBK mice.", "journal": "J. Neurosci.", "date": "2001", "authors": "Ichikawa T., Kobayashi T., Kumanishi T., Ikeda K., Niki H., Yano R.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "11160404", "url": "https://glygen.org/publication/PubMed/11160404" } ] }, { "title": "Generation of the mu opioid receptor (MOR-1) protein by three new splice variants of the Oprm gene.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2001", "authors": "Xu J., Xu M., Mahurter L., Pan Y.X., Pasternak G.W., Bolan E.", "evidence": [ { "database": "UniProtKB", "id": "Q4U2P0", "url": "https://www.uniprot.org/uniprot/Q4U2P0" }, { "database": "UniProtKB", "id": "Q4U2P1", "url": "https://www.uniprot.org/uniprot/Q4U2P1" }, { "database": "UniProtKB", "id": "Q4U2P9", "url": "https://www.uniprot.org/uniprot/Q4U2P9" }, { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "11717463", "url": "https://glygen.org/publication/PubMed/11717463" } ] }, { "title": "Dimerization of morphine and orphanin FQ/nociceptin receptors: generation of a novel opioid receptor subtype.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Pan Y.X., Pasternak G.W., Bolan E.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "12270145", "url": "https://glygen.org/publication/PubMed/12270145" } ] }, { "title": "Opioid agonists have different efficacy profiles for G protein activation, rapid desensitization, and endocytosis of mu-opioid receptors.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Osborne P.B., Christie M.J., Borgland S.L., Connor M., Furness J.B.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "12642578", "url": "https://glygen.org/publication/PubMed/12642578" } ] }, { "title": "A novel endocytic recycling signal that distinguishes the membrane trafficking of naturally occurring opioid receptors.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Tanowitz M, von Zastrow M", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "12939277", "url": "https://glygen.org/publication/PubMed/12939277" } ] }, { "title": "Distinct domains of the mu-opioid receptor control uncoupling and internalization.", "journal": "Molecular pharmacology", "date": "2004", "authors": "Celver J, Xu M, Jin W, Lowe J, Chavkin C", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "14978231", "url": "https://glygen.org/publication/PubMed/14978231" } ] }, { "title": "Genetic analysis of the murine mu opioid receptor: increased complexity of Oprm gene splicing.", "journal": "J. Mol. Med.", "date": "2004", "authors": "Krokan H.E., Skorpen F., Baar C., Kaasa S., Rakvag T.T., Kvam T.M.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "14991152", "url": "https://glygen.org/publication/PubMed/14991152" } ] }, { "title": "The RGSZ2 protein exists in a complex with mu-opioid receptors and regulates the desensitizing capacity of Gz proteins.", "journal": "Neuropsychopharmacology", "date": "2005", "authors": "Garzon J, Rodriguez-Munoz M, Lopez-Fando A, Sanchez-Blazquez P", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "15827571", "url": "https://glygen.org/publication/PubMed/15827571" } ] }, { "title": "Identification of four novel exon 5 splice variants of the mouse mu-opioid receptor gene: functional consequences of C-terminal splicing.", "journal": "Mol. Pharmacol.", "date": "2005", "authors": "Xu J., Xu M., Pan Y.X., Pasternak G.W., Bolan E., Moskowitz H.S.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "15939800", "url": "https://glygen.org/publication/PubMed/15939800" } ] }, { "title": "mu opioid and CB1 cannabinoid receptor interactions: reciprocal inhibition of receptor signaling and neuritogenesis.", "journal": "Br. J. Pharmacol.", "date": "2006", "authors": "Devi L.A., Gomes I., Rios C.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "16682964", "url": "https://glygen.org/publication/PubMed/16682964" } ] }, { "title": "Translational repression of mouse mu opioid receptor expression via leaky scanning.", "journal": "Nucleic acids research", "date": "2007", "authors": "Song KY, Hwang CK, Kim CS, Choi HS, Law PY, Wei LN, Loh HH", "evidence": [ { "database": "RefSeq", "id": "NP_001034741", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034741" } ], "reference": [ { "type": "PubMed", "id": "17284463", "url": "https://glygen.org/publication/PubMed/17284463" } ] }, { "title": "Identification of five mouse mu-opioid receptor (MOR) gene (Oprm1) splice variants containing a newly identified alternatively spliced exon.", "journal": "Gene", "date": "2007", "authors": "Grice D.E., Berrettini W.H., Lin S.S., Ferraro T.N., Doyle G.A., Buono R.J., Press D.M., Sheng X.R.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "17398041", "url": "https://glygen.org/publication/PubMed/17398041" } ] }, { "title": "RGS9-2 is a negative modulator of mu-opioid receptor function.", "journal": "J. Neurochem.", "date": "2007", "authors": "Neve R.L., Kardassis D., Russo S.J., Gold S.J., Papakosta P., Psifogeorgou K., Zachariou V.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "17725581", "url": "https://glygen.org/publication/PubMed/17725581" } ] }, { "title": "RGS14 prevents morphine from internalizing Mu-opioid receptors in periaqueductal gray neurons.", "journal": "Cellular signalling", "date": "2007", "authors": "Rodriguez-Munoz M, de la Torre-Madrid E, Gaitan G, Sanchez-Blazquez P, Garzon J", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "17825524", "url": "https://glygen.org/publication/PubMed/17825524" } ] }, { "title": "Multiple actions of spinophilin regulate mu opioid receptor function.", "journal": "Neuron", "date": "2008", "authors": "Greengard P., Neve R.L., Chakravarty S., Devi L.A., Gomes I., Nestler E.J., Allen P.B., Charlton J.J., Psifogeorgou K., Zachariou V.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "18439408", "url": "https://glygen.org/publication/PubMed/18439408" } ] }, { "title": "Cell surface targeting of mu-delta opioid receptor heterodimers by RTP4.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2008", "authors": "Decaillot FM, Rozenfeld R, Gupta A, Devi LA", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "18836069", "url": "https://glygen.org/publication/PubMed/18836069" } ] }, { "title": "Src phosphorylation of micro-receptor is responsible for the receptor switching from an inhibitory to a stimulatory signal.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Zhang L, Zhao H, Qiu Y, Loh HH, Law PY", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "19029294", "url": "https://glygen.org/publication/PubMed/19029294" } ] }, { "title": "The histidine triad nucleotide-binding protein 1 supports mu-opioid receptor-glutamate NMDA receptor cross-regulation.", "journal": "Cell. Mol. Life Sci.", "date": "2011", "authors": "Bailon C., Garzon J., Martin-Aznar B., Rodriguez-Munoz M., Sanchez-Blazquez P., Vicente-Sanchez A.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "21153910", "url": "https://glygen.org/publication/PubMed/21153910" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" }, { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Heteromerization of the mu- and delta-opioid receptors produces ligand-biased antagonism and alters mu-receptor trafficking.", "journal": "J. Pharmacol. Exp. Ther.", "date": "2011", "authors": "Whistler J.L., Milan-Lobo L.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "21422164", "url": "https://glygen.org/publication/PubMed/21422164" } ] }, { "title": "Unidirectional cross-activation of GRPR by MOR1D uncouples itch and analgesia induced by opioids.", "journal": "Cell", "date": "2011", "authors": "Kim S., Kim J.Y., Ross M., Liu X.Y., Li Q.F., Chen Z.F., Loh H.H., Sun Y.G., Jeffry J., Liu Z.C., Tsai F.F.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "22000021", "url": "https://glygen.org/publication/PubMed/22000021" } ] }, { "title": "Crystal structure of the micro-opioid receptor bound to a morphinan antagonist.", "journal": "Nature", "date": "2012", "authors": "Weis W.I., Kobilka B.K., Kobilka T.S., Kruse A.C., Manglik A., Sunahara R.K., Thian F.S., Pardo L., Granier S., Mathiesen J.M.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "22437502", "url": "https://glygen.org/publication/PubMed/22437502" } ] }, { "title": "Global identification and characterization of both O-GlcNAcylation and phosphorylation at the murine synapse.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Trinidad JC, Barkan DT, Gulledge BF, Thalhammer A, Sali A, Schoepfer R, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Database", "id": "P42866", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P42866" } ], "reference": [ { "type": "PubMed", "id": "22645316", "url": "https://glygen.org/publication/PubMed/22645316" } ] }, { "title": "Loss of morphine reward and dependence in mice lacking G protein-coupled receptor kinase 5.", "journal": "Biological psychiatry", "date": "2014", "authors": "Gluck L, Loktev A, Mouledous L, Mollereau C, Law PY, Schulz S", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "24629717", "url": "https://glygen.org/publication/PubMed/24629717" } ] }, { "title": "Cell-autonomous regulation of Mu-opioid receptor recycling by substance P.", "journal": "Cell reports", "date": "2015", "authors": "Bowman SL, Soohoo AL, Shiwarski DJ, Schulz S, Pradhan AA, Puthenveedu MA", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "25801029", "url": "https://glygen.org/publication/PubMed/25801029" } ] }, { "title": "Role of G Protein-Coupled Receptor Kinases 2 and 3 in \u03bc-Opioid Receptor Desensitization and Internalization.", "journal": "Molecular pharmacology", "date": "2015-08", "authors": "Lowe Janet D, Sanderson Helen S, Cooke Alexandra E, Ostovar Mehrnoosh, Tsisanova Elena, Withey Sarah L, Chavkin Charles, Husbands Stephen M, Kelly Eamonn, Henderson Graeme, Bailey Chris P", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "26013542", "url": "https://glygen.org/publication/PubMed/26013542" } ] }, { "title": "Phosphoproteomic analysis of the mouse brain mu-opioid (MOP) receptor.", "journal": "FEBS letters", "date": "2015", "authors": "Mouledous L, Froment C, Burlet-Schiltz O, Schulz S, Mollereau C", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "26226422", "url": "https://glygen.org/publication/PubMed/26226422" } ] }, { "title": "Structural insights into u-opioid receptor activation.", "journal": "Nature", "date": "2015", "authors": "Huang W., Weis W.I., Gmeiner P., Kobilka B.K., Manglik A., Steyaert J., Dror R.O., Venkatakrishnan A.J., Feinberg E.N., Granier S., Husbands S.M., Kato H.E., Kling R.C., Laeremans T., Livingston K.E., Sanborn A.L., Thorsen T.S., Traynor J.R.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "26245379", "url": "https://glygen.org/publication/PubMed/26245379" } ] }, { "title": "T394A Mutation at the mu Opioid Receptor Blocks Opioid Tolerance and Increases Vulnerability to Heroin Self-Administration in Mice.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2016", "authors": "Wang XF, Barbier E, Chiu YT, He Y, Zhan J, Bi GH, Zhang HY, Feng B, Liu-Chen LY, Wang JB, Xi ZX", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "27707973", "url": "https://glygen.org/publication/PubMed/27707973" } ] }, { "title": "Src-dependent phosphorylation of mu-opioid receptor at Tyr(336) modulates opiate withdrawal.", "journal": "EMBO molecular medicine", "date": "2017", "authors": "Zhang L, Kibaly C, Wang YJ, Xu C, Song KY, McGarrah PW, Loh HH, Liu JG, Law PY", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "28818835", "url": "https://glygen.org/publication/PubMed/28818835" } ] }, { "title": "Convallatoxin enhance the ligand-induced mu-opioid receptor endocytosis and attenuate morphine antinociceptive tolerance in mice.", "journal": "Scientific reports", "date": "2019", "authors": "Chao PK, Chang HF, Ou LC, Chuang JY, Lee PT, Chang WT, Chen SC, Ueng SH, Hsu JT, Tao PL, Law PY, Loh HH, Yeh SH", "evidence": [ { "database": "iPTMnet", "id": "P42866", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42866" } ], "reference": [ { "type": "PubMed", "id": "30787373", "url": "https://glygen.org/publication/PubMed/30787373" } ] }, { "title": "Angiotensin-converting enzyme gates brain circuit-specific plasticity via an endogenous opioid.", "journal": "Science", "date": "2022", "authors": "Trieu BH, Remmers BC, Toddes C, Brandner DD, Lefevre EM, Kocharian A, Retzlaff CL, Dick RM, Mashal MA, Gauthier EA, Xie W, Zhang Y, More SS, Rothwell PE", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "35201898", "url": "https://glygen.org/publication/PubMed/35201898" } ] }, { "title": "Human OPRM1 and murine Oprm1 promoter driven viral constructs for genetic access to \u03bc-opioidergic cell types.", "journal": "Nature communications", "date": "2023-09-13", "authors": "Salimando Gregory J, Tremblay S\u00e9bastien, Kimmey Blake A, Li Jia, Rogers Sophie A, Wojick Jessica A, McCall Nora M, Wooldridge Lisa M, Rodrigues Amrith, Borner Tito, Gardiner Kristin L, Jayakar Selwyn S, Singe\u00e7 Ilyas, Woolf Clifford J, Hayes Matthew R, De Jonghe Bart C, Bennett F Christian, Bennett Mariko L, Blendy Julie A, Platt Michael L, Creasy Kate Townsend, Renthal William R, Ramakrishnan Charu, Deisseroth Karl, Corder Gregory", "evidence": [ { "database": "RefSeq", "id": "NP_001034741", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034741" } ], "reference": [ { "type": "PubMed", "id": "37704594", "url": "https://glygen.org/publication/PubMed/37704594" } ] }, { "title": "Analgesic activity of the naturally occurring heptapeptide [Met]enkephalin-Arg6-Phe7.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1980", "authors": "Stein S., Udenfriend S., Stern A.S., Wolff D., Inturrisi C.E., Lewis R.V., Umans J.G.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "6933569", "url": "https://glygen.org/publication/PubMed/6933569" } ] }, { "title": "Antisense mapping the MOR-1 opioid receptor: evidence for alternative splicing and a novel morphine-6 beta-glucuronide receptor.", "journal": "FEBS Lett.", "date": "1995", "authors": "Rossi GC, Pan YX, Brown GP, Pasternak GW", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "7649256", "url": "https://glygen.org/publication/PubMed/7649256" } ] }, { "title": "Characterization of the murine mu opioid receptor gene.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Tian J., Tran T., Magendzo K., Newman D., Xia Y., Lusis A.J., Lee D.S., Kaufman D.L., Wen C., Keith D.E., Evans C.J., Anton B.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "7797593", "url": "https://glygen.org/publication/PubMed/7797593" } ] }, { "title": "Genomic structure analysis of promoter sequence of a mouse mu opioid receptor gene.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1994", "authors": "Loh H.H., Min B.H., Augustin L.B., Felsheim R.F., Fuchs J.A.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "8090773", "url": "https://glygen.org/publication/PubMed/8090773" } ] }, { "title": "Opiate receptor knockout mice define mu receptor roles in endogenous nociceptive responses and morphine-induced analgesia.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Miner L.L., Takahashi N., Uhl G.R., Ujike H., Donovan D.M., Sora I., Funada M., Revay R.S.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "9037090", "url": "https://glygen.org/publication/PubMed/9037090" } ] }, { "title": "Influence of Gz and Gi2 transducer proteins in the affinity of opioid agonists to mu receptors.", "journal": "Eur. J. Neurosci.", "date": "1998", "authors": "Castro M., Garzon J., Sanchez-Blazquez P.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "reference": [ { "type": "PubMed", "id": "9767386", "url": "https://glygen.org/publication/PubMed/9767386" } ] } ], "pathway": [ { "id": "mmu:18390", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18390", "resource": "KEGG Pathway" }, { "id": "R-MMU-111885", "name": "Opioid Signalling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-111885", "resource": "Reactome", "description": "Opioid Signalling" }, { "id": "R-MMU-202040", "name": "G-protein activation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-202040", "resource": "Reactome", "description": "G-protein activation" }, { "id": "R-MMU-375276", "name": "Peptide ligand-binding receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-375276", "resource": "Reactome", "description": "Peptide ligand-binding receptors" }, { "id": "R-MMU-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "P33535-1", "protein_name": "Mu-type opioid receptor", "gene_name": "Oprm1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP", "length": 398 }, "evidence": [ { "id": "45224179", "url": "http://www.informatics.jax.org/homology/45224179", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P35372-1", "protein_name": "Mu-type opioid receptor", "gene_name": "OPRM1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSNIEQQNSTRIRQNTRDHPSTANTVDRTNHQLENLEAETAPLP", "length": 400 }, "evidence": [ { "id": "45224179", "url": "http://www.informatics.jax.org/homology/45224179", "database": "MGI" }, { "id": "P42866", "url": "https://omabrowser.org/oma/group/P42866/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 15, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "perikaryon", "id": "GO:0043204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043204", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "GABA-ergic synapse", "id": "GO:0098982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098982", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "postsynaptic membrane", "id": "GO:0045211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045211", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "dendrite cytoplasm", "id": "GO:0032839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032839", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "sarcolemma", "id": "GO:0042383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042383", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "presynaptic membrane", "id": "GO:0042734", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042734", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "dendrite membrane", "id": "GO:0032590", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032590", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "spine apparatus", "id": "GO:0097444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097444", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "beta-endorphin receptor activity", "id": "GO:0004979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004979", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "G-protein alpha-subunit binding", "id": "GO:0001965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001965", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "G protein-coupled opioid receptor activity", "id": "GO:0004985", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004985", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "G-protein beta-subunit binding", "id": "GO:0031681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031681", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "filamin binding", "id": "GO:0031005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031005", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "voltage-gated calcium channel activity", "id": "GO:0005245", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005245", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "morphine receptor activity", "id": "GO:0038047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038047", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "neuropeptide binding", "id": "GO:0042923", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042923", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 28, "go_terms": [ { "name": "behavioral response to ethanol", "id": "GO:0048149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048149", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "negative regulation of Wnt protein secretion", "id": "GO:0061358", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061358", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "regulation of cellular response to stress", "id": "GO:0080135", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0080135", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "positive regulation of appetite", "id": "GO:0032100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032100", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway", "id": "GO:0007193", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007193", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway", "id": "GO:0007197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007197", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "positive regulation of cytosolic calcium ion concentration", "id": "GO:0007204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "neuropeptide signaling pathway", "id": "GO:0007218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007218", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "locomotory behavior", "id": "GO:0007626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007626", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "positive regulation of nitric oxide biosynthetic process", "id": "GO:0045429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045429", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "excitatory postsynaptic potential", "id": "GO:0060079", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060079", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "regulation of NMDA receptor activity", "id": "GO:2000310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000310", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "sensory perception of pain", "id": "GO:0019233", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019233", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "eating behavior", "id": "GO:0042755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042755", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "phospholipase C-activating G protein-coupled receptor signaling pathway", "id": "GO:0007200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007200", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "adenylate cyclase-activating dopamine receptor signaling pathway", "id": "GO:0007191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007191", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "positive regulation of cAMP-mediated signaling", "id": "GO:0043950", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043950", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "negative regulation of nitric oxide biosynthetic process", "id": "GO:0045019", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045019", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "negative regulation of cAMP-mediated signaling", "id": "GO:0043951", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043951", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "negative regulation of cytosolic calcium ion concentration", "id": "GO:0051481", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051481", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "positive regulation of neurogenesis", "id": "GO:0050769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050769", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "adenylate cyclase-inhibiting opioid receptor signaling pathway", "id": "GO:0031635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031635", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "G protein-coupled opioid receptor signaling pathway", "id": "GO:0038003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038003", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "presynaptic modulation of chemical synaptic transmission", "id": "GO:0099171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099171", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" }, { "name": "negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway", "id": "GO:0106072", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106072", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 31, "end_pos": 33, "annotation": "n_glycosylation_sequon" }, { "start_pos": 38, "end_pos": 40, "annotation": "n_glycosylation_sequon" }, { "start_pos": 46, "end_pos": 48, "annotation": "n_glycosylation_sequon" }, { "start_pos": 9, "end_pos": 11, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated. Differentially phosphorylated in basal and agonist-induced conditions. Agonist-mediated phosphorylation modulates receptor internalization. Phosphorylated by GRK2 in a agonist-dependent manner. Phosphorylation at Tyr-166 requires receptor activation, is dependent on non-receptor protein tyrosine kinase Src and results in a decrease in agonist efficacy by reducing G-protein coupling efficiency. Phosphorylated on tyrosine residues; the phosphorylation is involved in agonist-induced G-protein-independent receptor down-regulation. Phosphorylation at Ser-375 is involved in G-protein-dependent but not beta-arrestin-dependent activation of the ERK pathway.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" }, { "database": "PubMed", "id": "P33535", "url": "https://glygen.org/publication/PubMed/P33535" } ] }, { "annotation": "Ubiquitinated. A basal ubiquitination seems not to be related to degradation. Ubiquitination is increased upon formation of OPRM1:OPRD1 oligomers leading to proteasomal degradation; the ubiquitination is diminished by RTP4.", "evidence": [ { "database": "UniProtKB", "id": "P42866", "url": "https://www.uniprot.org/uniprot/P42866" }, { "database": "PubMed", "id": "18836069", "url": "https://glygen.org/publication/PubMed/18836069" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 42 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }