{ "uniprot_canonical_ac": "P42826-1", "uniprot_ac": "P42826", "uniprot_id": "XKS1_YEAST", "mass": { "chemical_mass": 68321.0, "monoisotopic_mass": 68321.0 }, "refseq": { "ac": "NP_011710", "name": "xylulokinase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011710" }, "gene_names": [ { "name": "XKS1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P42826", "id": "P42826" }, { "name": "G7584", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P42826", "id": "P42826" }, { "name": "XKS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011710", "id": "NP_011710" } ], "protein_names": [ { "name": "Xylulose kinase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P42826" }, { "name": "2.7.1.17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P42826" }, { "name": "Xylulokinase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P42826" }, { "name": "xylulokinase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011710", "id": "NP_011710" } ], "function": [ { "annotation": "Xylulose kinase necessary for growth in culture media with D-xylulose as the solecarbon source.", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826#function" }, { "database": "PubMed", "id": "9595677", "url": "https://glygen.org/publication/PubMed/9595677" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "common_name": "Yeast" } ], "gene": [ { "name": "XKS1", "url": "https://www.uniprot.org/uniprot/P42826", "locus": {} } ], "crossref": [ { "id": "2.7.1.17", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.1.17&UniProtAcc=P42826", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd07776", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07776", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "853108", "url": "https://www.ncbi.nlm.nih.gov/gene/853108", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P42826", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42826*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR018484", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018484", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018485", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018485", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043129", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043129", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YGR194C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR194C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NSCALGG", "url": "https://omabrowser.org/oma/group/NSCALGG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1704034at2759", "url": "http://www.orthodb.org/?query=1704034at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10196", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10196", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10196:SF57", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10196:SF57", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00370", "url": "http://pfam.xfam.org/family/PF00370", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02782", "url": "http://pfam.xfam.org/family/PF02782", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P42826", "url": "http://purl.obolibrary.org/obo/PR_P42826", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_011710", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011710", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000003426", "url": "https://www.yeastgenome.org/locus/S000003426", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42826-1", "url": "https://www.uniprot.org/uniprot/P42826-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLCSVIQRQTREVSNTMSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGDTIECPVAMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLLHYVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQLEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSSKDKTIRQKLMRAPMKNLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKNDVLVSLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKERENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIFNPKTGMIEREVAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIVKFDYDESPLRDYLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDSNKIAVPFDKFLNDNFPWHVMESISDVDNENWDRYNSKIVPLSELEKTLI", "length": 600, "header": "sp|P42826-1|XKS1_YEAST Isoform 1 of Xylulose kinase OS=Saccharomyces cerevisiae S288C OX=559292 GN=XKS1 PE=1 SV=2 CANONICAL=P42826-1" }, "isoforms": [ { "isoform_ac": "P42826-1", "url": "", "sequence": { "sequence": "MLCSVIQRQTREVSNTMSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGDTIECPVAMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLLHYVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQLEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSSKDKTIRQKLMRAPMKNLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKNDVLVSLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKERENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIFNPKTGMIEREVAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIVKFDYDESPLRDYLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDSNKIAVPFDKFLNDNFPWHVMESISDVDNENWDRYNSKIVPLSELEKTLI", "length": 600, "header": "sp|P42826-1|XKS1_YEAST Isoform 1 of Xylulose kinase OS=Saccharomyces cerevisiae S288C OX=559292 GN=XKS1 PE=1 SV=2 CANONICAL=P42826-1" }, "locus": { "chromosome": "VII", "start_pos": 887875, "end_pos": 886076, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YGR194C_mRNA", "url": "https://www.ensembl.org/id/YGR194C_mRNA" }, { "database": "Ensembl Peptide", "id": "YGR194C", "url": "https://www.ensembl.org/id/YGR194C" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 244, "end_pos": 244, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P42826", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42826" }, { "database": "SGD", "id": "P42826", "url": "https://www.yeastgenome.org/locus/P42826" } ], "site_lbl": "Ser244" }, { "start_pos": 460, "end_pos": 460, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42826", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42826" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Ser460" }, { "start_pos": 593, "end_pos": 593, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42826", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42826" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ], "site_lbl": "Ser593" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" }, { "database": "iPTMnet", "id": "P42826", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42826" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "P42826", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42826" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "P42826", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42826" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P42826", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42826" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The complete sequence of a 9037 bp DNA fragment of the right arm of Saccharomyces cerevisiae chromosome VII.", "journal": "Yeast", "date": "1995", "authors": "Sanchez M., Nombela C., Arroyo J., Garcia-Gonzalez M., Garcia-Saez M.I.", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "reference": [ { "type": "PubMed", "id": "7645350", "url": "https://glygen.org/publication/PubMed/7645350" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII.", "journal": "Nature", "date": "1997", "authors": "Mewes H.-W., Minenkova O., Schaefer M., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Hansen M., Rose M., Durand P., Brueckner M., Plevani P., Netter P., Rieger M., Zimmermann M., Portetelle D., Wolf K., Bertani I., Delius H., Kleine K., Portillo F., Hofmann B., Albers M., Schaefer B., Kramer W., Castagnoli L., Volckaert G., Koetter P., Entian K.-D., Kramer B., Rinaldi T., Thierry A., Louis E.J., Vandenbol M., Martegani E., Robben J., Nombela C., Vanoni M., Arroyo J., Eraso P., Mazon M.J., James C.M., Carignani G., Dujon B., Feuermann M., Goffeau A., Hani J., Hilger F., Klima R., Mueller-Auer S., Oliver S.G., Potier S., Rodrigues-Pousada C., Schmidheini T., Souciet J.-L., Steensma H.Y., Zollner A., Bruschi C.V., Escribano V., Frontali L., Guerreiro P., Mazzoni C., Purnelle B., Rodriguez-Torres A.M., Skala J., Talla E., Voet M., de Wergifosse P., Agostoni-Carbone M.L., Albermann K., Backes U., Barreiros T., Bjourson A.J., Cerdan E., Clemente M.L., Coblenz A., Coglievina M., Coissac E., Defoor E., Del Bino S., Delneri D., Fabiani L., Fartmann B., Feroli F., Garcia-Gonzalez M., Garcia-Saez M.I., Hebling U., Hernandez K., Heumann K., Indge K.J., Lauquin G., Leuther H., Maillier E., Marconi A., McReynolds A.D.K., Melchioretto P., Nawrocki A., Neu R., Panzeri L., Paoluzi S., Riles L., Rodriguez-Belmonte E., Ruzzi M., Saliola M., Sanchez-Perez M., Schreer A., Tettelin H., Van Dyck L., Watson M.D., Weber N., Wedler E., Wipfli P., Wright L.F., Zaccaria P., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "reference": [ { "type": "PubMed", "id": "9169869", "url": "https://glygen.org/publication/PubMed/9169869" } ] }, { "title": "The YGR194c (XKS1) gene encodes the xylulokinase from the budding yeast Saccharomyces cerevisiae.", "journal": "FEMS Microbiol. Lett.", "date": "1998", "authors": "Nombela C., Arroyo J., Cid V.J., Rodriguez-Pena J.M.", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "reference": [ { "type": "PubMed", "id": "9595677", "url": "https://glygen.org/publication/PubMed/9595677" } ] } ], "pathway": [ { "id": "sce:YGR194C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR194C", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O75191-1", "protein_name": "Xylulose kinase", "gene_name": "XYLB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE", "length": 536 }, "evidence": [ { "id": "P42826", "url": "https://omabrowser.org/oma/group/P42826/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q3TNA1-1", "protein_name": "Xylulose kinase", "gene_name": "Xylb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDARTHRRAAGTPRALAERAGRRCCLGWDFSTQQVKVVAVDAELNVFYEDSVHFDRDLPEFGTQGGVHVHKDRLTVTSPVLMWVQALDLILGKMKSSGFDFSQVLALSGAGQQHGSVYWKTGASLALSSLSPALPLHQQLQSCFSISDCPIWMDSSTTAQCHQLEAAVGGAQALSCLTGSRAYERFTGNQIAKLFQKNPEAYSHSERISLVSSFAASLFLGGYSPIDYSDGSGMNLLQIQEKVWSQACLDVCAPHLEEKLGSPVPSCSVVGTISSYYVQRYGFPPGCKVVAFSGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQKPMPALEGHIFCNPVDPQHYMALLCFKNGSLMREKIRDESASCSWNKFSKALKSTAMGNNGNLGFYFDVMEITPEIIGRHRFNAENMEVSAFPGDVEIRALIEGQFMAKRIHAEGLGYRVMPKTKILATGGASHNKDILQVLADVFGAPVYVIDTTSSACVGSAYRAFHGLAGGTGVAFSEVVKSAPQPSLAATPNPGASQVYAALLPRYSALEQRILSTAQRPLE", "length": 551 }, "evidence": [ { "id": "P42826", "url": "https://omabrowser.org/oma/group/P42826/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "xylulose metabolic process", "id": "GO:0005997", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005997", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "pmid": "" }, { "name": "D-xylose metabolic process", "id": "GO:0042732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042732", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "pmid": "" }, { "name": "xylulose catabolic process", "id": "GO:0005998", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005998", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "pmid": "" }, { "name": "xylulokinase activity", "id": "GO:0004856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004856", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P42826", "url": "https://www.uniprot.org/uniprot/P42826" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 357, "end_pos": 359, "annotation": "n_glycosylation_sequon" }, { "start_pos": 467, "end_pos": 469, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10964", "name": "", "equation": "ATP + D-xylulose = ADP + D-xylulose 5-phosphate + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q3MIF4-1", "O75191-1", "Q3TNA1-1", "P42826-1", "Q9VEQ0-1", "Q9VPT2-1" ], "evidence": [ { "id": "10964", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10964" } ] }, { "id": "R-SCE-5662466", "name": "XYLB phosphorylates D-xylulose", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-29790" ], "enzyme_list": [ "P42826-1" ], "evidence": [ { "id": "R-SCE-5662466", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-5662466" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-29790", "participant_name": "XY5P [cytosol]", "crossref": [ { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" }, { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "C00231", "database": "COMPOUND", "url": "" }, { "id": "57737", "database": "ChEBI", "url": "" }, { "id": "000030320708", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O75191", "gene_name": "XYLB", "activity": [ { "ec_number": "2.7.1.17", "activity": "ATP + D-xylulose = ADP + D-xylulose 5-phosphate + H(+).", "evidence": [ { "id": "O75191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75191" } ] }, { "ec_number": "2.7.1.17", "activity": "", "evidence": [ { "id": "O75191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75191" } ] } ] }, { "uniprot_ac": "P42826", "gene_name": "XKS1", "activity": [ { "ec_number": "2.7.1.17", "activity": "ATP + D-xylulose = ADP + D-xylulose 5-phosphate + H(+).", "evidence": [ { "id": "P42826", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42826" } ] }, { "ec_number": "2.7.1.17", "activity": "", "evidence": [ { "id": "P42826", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42826" } ] } ] }, { "uniprot_ac": "Q3MIF4", "gene_name": "Xylb", "activity": [ { "ec_number": "2.7.1.17", "activity": "ATP + D-xylulose = ADP + D-xylulose 5-phosphate + H(+).", "evidence": [ { "id": "Q3MIF4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MIF4" } ] }, { "ec_number": "2.7.1.17", "activity": "", "evidence": [ { "id": "Q3MIF4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MIF4" } ] } ] }, { "uniprot_ac": "Q3TNA1", "gene_name": "Xylb", "activity": [ { "ec_number": "2.7.1.17", "activity": "ATP + D-xylulose = ADP + D-xylulose 5-phosphate + H(+).", "evidence": [ { "id": "Q3TNA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TNA1" } ] }, { "ec_number": "2.7.1.17", "activity": "", "evidence": [ { "id": "Q3TNA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TNA1" } ] } ] }, { "uniprot_ac": "Q9VEQ0", "gene_name": "Dmel\\CG3534", "activity": [ { "ec_number": "2.7.1.17", "activity": "ATP + D-xylulose = ADP + D-xylulose 5-phosphate + H(+).", "evidence": [ { "id": "Q9VEQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VEQ0" } ] }, { "ec_number": "2.7.1.17", "activity": "", "evidence": [ { "id": "Q9VEQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VEQ0" } ] } ] }, { "uniprot_ac": "Q9VPT2", "gene_name": "Dmel\\CG3544", "activity": [ { "ec_number": "2.7.1.17", "activity": "ATP + D-xylulose = ADP + D-xylulose 5-phosphate + H(+).", "evidence": [ { "id": "Q9VPT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VPT2" } ] }, { "ec_number": "2.7.1.17", "activity": "", "evidence": [ { "id": "Q9VPT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VPT2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }