{ "uniprot_canonical_ac": "P42695-1", "uniprot_ac": "P42695", "uniprot_id": "CNDD3_HUMAN", "mass": { "chemical_mass": 168891.0, "monoisotopic_mass": 168891.0 }, "refseq": { "ac": "NP_056076", "name": "condensin-2 complex subunit D3 isoform 1", "summary": "Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPD3 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM, Mar 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076" }, "gene_names": [ { "name": "NCAPD3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P42695", "id": "P42695" }, { "name": "CAP-D3; CAPD3; hCAP-D3; hcp-6; hHCP-6; MCPH22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076", "id": "NP_056076" }, { "name": "CAPD3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P42695", "id": "P42695" }, { "name": "KIAA0056", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P42695", "id": "P42695" }, { "name": "NCAPD3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076", "id": "NP_056076" }, { "name": "hCAP-D3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P42695", "id": "P42695" }, { "name": "hCG_37608", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P42695", "id": "P42695" } ], "protein_names": [ { "name": "Condensin-2 complex subunit D3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P42695" }, { "name": "Non-SMC condensin II complex subunit D3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P42695" }, { "name": "condensin-2 complex subunit D3 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076", "id": "NP_056076" }, { "name": "condensin-2 complex subunit D3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076", "id": "NP_056076" }, { "name": "hCAP-D3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P42695" } ], "function": [ { "annotation": "Condensin II(CAP-D3 and CAP-H2) and GAIT subunits associate with L1 RNA in a co-dependent manner, independent of IFN-gamma. These findings suggest that cooperation between the Condensin II and GAIT complexes may facilitate a novel mechanism of L1 repression, thus contributing to the maintenance of genome stability in somatic cells Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_056076", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076" }, { "database": "PubMed", "id": "29028794", "url": "https://glygen.org/publication/PubMed/29028794" } ] }, { "annotation": "Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPD3 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM, Mar 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_056076", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076" } ] }, { "annotation": "NCAPD2 and NCAPD3 expression levels have been confirmed to be significantly up-regulated in the intestinal mucosa of patients with active ulcerative colitis. In vitro, the data suggested that silencing NACPD2 and NACPD3 could depress the expression of IL-1beta, IL-6 and TNF-alpha. Further, knockdown of NACPD2 and NACPD3 could remarkably suppress IKK nucleation and NF-kappaB volume.", "evidence": [ { "database": "RefSeq", "id": "NP_056076", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076" }, { "database": "PubMed", "id": "31885422", "url": "https://glygen.org/publication/PubMed/31885422" } ] }, { "annotation": "NCAPD3 promotes prostate cancer progression by up-regulating EZH2 and MALAT1 through STAT3 and E2F1.", "evidence": [ { "database": "RefSeq", "id": "NP_056076", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076" }, { "database": "PubMed", "id": "35085770", "url": "https://glygen.org/publication/PubMed/35085770" } ] }, { "annotation": "Regulatory subunit of the condensin-2 complex, a complex which establishes mitotic chromosome architecture and is involved in physical rigidity of the chromatid axis (PubMed:14532007). May promote the resolution of double-strand DNA catenanes (intertwines) between sister chromatids. Condensin-mediated compaction likely increases tension in catenated sister chromatids, providing directionality for type II topoisomerase-mediated strand exchanges toward chromatid decatenation. Specifically required for decatenation of centromeric ultrafine DNA bridges during anaphase. Early in neurogenesis, may play an essential role to ensure accurate mitotic chromosome condensation in neuron stem cells, ultimately affecting neuron pool and cortex size (PubMed:27737959).", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695#function" }, { "database": "PubMed", "id": "14532007", "url": "https://glygen.org/publication/PubMed/14532007" }, { "database": "PubMed", "id": "27737959", "url": "https://glygen.org/publication/PubMed/27737959" }, { "database": "UniProtKB", "id": "A0A8I5KT00", "url": "https://www.uniprot.org/uniprot/A0A8I5KT00#function" }, { "database": "UniProtKB", "id": "PIRNR036508", "url": "https://www.uniprot.org/uniprot/PIRNR036508#function" }, { "database": "UniProtKB", "id": "G3V1A9", "url": "https://www.uniprot.org/uniprot/G3V1A9#function" } ] }, { "annotation": "The CAP-D3 subunit of the condensin II complex implicated in chromosome assembly and segeregation", "evidence": [ { "database": "RefSeq", "id": "NP_056076", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076" }, { "database": "PubMed", "id": "14532007", "url": "https://glygen.org/publication/PubMed/14532007" } ] } ], "disease": [ { "disease_id": "MONDO:0054805", "recommended_name": { "id": "MONDO:0054805", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0054805", "name": "microcephaly 22, primary, autosomal recessive", "description": "" }, "synonyms": [ { "id": "MONDO:0054805", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0054805", "name": "MCPH22", "description": "" }, { "id": "MONDO:0054805", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0054805", "name": "microcephaly 22, PRIMARY, autosomal recessive", "description": "" }, { "id": "MIM:617984", "resource": "MIM", "url": "https://www.omim.org/entry/617984", "name": "Microcephaly 22, primary, autosomal recessive", "description": "Microcephaly 22, primary, autosomal recessive" } ], "evidence": [ { "id": "617984", "database": "MIM", "url": "https://www.omim.org/entry/617984" } ] }, { "disease_id": "MONDO:0054806", "recommended_name": { "id": "MONDO:0054806", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0054806", "name": "microcephaly 23, primary, autosomal recessive", "description": "" }, "synonyms": [ { "id": "MONDO:0054806", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0054806", "name": "MCPH23", "description": "" }, { "id": "MONDO:0054806", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0054806", "name": "microcephaly 23, PRIMARY, autosomal recessive", "description": "" }, { "id": "MIM:617985", "resource": "MIM", "url": "https://www.omim.org/entry/617985", "name": "Microcephaly 23, primary, autosomal recessive", "description": "Microcephaly 23, primary, autosomal recessive" } ], "evidence": [ { "id": "617985", "database": "MIM", "url": "https://www.omim.org/entry/617985" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "71.95", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "74.11", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "82.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "70.24", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "81.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "86.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "76.89", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "76.83", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "83.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "69.26", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "86.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "91.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "82.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P42695", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P42695" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "common_name": "Human" } ], "gene": [ { "name": "NCAPD3", "url": "https://www.uniprot.org/uniprot/P42695", "locus": { "chromosome": "11", "start_pos": 134150113, "end_pos": 134225504, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000151503", "url": "https://www.ensembl.org/id/ENSG00000151503" } ] } } ], "crossref": [ { "id": "ENSG00000151503", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000151503", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "NCAPD3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NCAPD3", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "23310", "url": "https://www.ncbi.nlm.nih.gov/gene/23310", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "28952", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=28952", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P42695", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42695*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR011989", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011989", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012371", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012371", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026971", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026971", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032682", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032682", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:23310", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:23310", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "609276", "url": "http://www.omim.org/entry/609276", "database": "MIM", "categories": [ "Other" ] }, { "id": "617984", "url": "http://www.omim.org/entry/617984", "database": "MIM", "categories": [ "Other" ] }, { "id": "617985", "url": "http://www.omim.org/entry/617985", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P42695", "url": "https://www.nextprot.org/entry/NX_P42695", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "RIHPNIC", "url": "https://omabrowser.org/oma/group/RIHPNIC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "38442at2759", "url": "http://www.orthodb.org/?query=38442at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14222", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14222", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14222:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14222:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF12717", "url": "http://pfam.xfam.org/family/PF12717", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P42695", "url": "https://pharos.nih.gov/targets/P42695", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P42695", "url": "http://purl.obolibrary.org/obo/PR_P42695", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_056076", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A8I5KR13", "url": "https://www.uniprot.org/uniprot/A0A8I5KR13", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KR13-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KR13-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KRL1", "url": "https://www.uniprot.org/uniprot/A0A8I5KRL1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KRL1-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KRL1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KT00", "url": "https://www.uniprot.org/uniprot/A0A8I5KT00", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KT00-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KT00-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KTC8", "url": "https://www.uniprot.org/uniprot/A0A8I5KTC8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KTC8-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KTC8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KTD5", "url": "https://www.uniprot.org/uniprot/A0A8I5KTD5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KTD5-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KTD5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KYN6", "url": "https://www.uniprot.org/uniprot/A0A8I5KYN6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KYN6-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KYN6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5QKI5", "url": "https://www.uniprot.org/uniprot/A0A8I5QKI5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5QKI5-1", "url": "https://www.uniprot.org/uniprot/A0A8I5QKI5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5QKQ4", "url": "https://www.uniprot.org/uniprot/A0A8I5QKQ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5QKQ4-1", "url": "https://www.uniprot.org/uniprot/A0A8I5QKQ4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5QKW0", "url": "https://www.uniprot.org/uniprot/A0A8I5QKW0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5QKW0-1", "url": "https://www.uniprot.org/uniprot/A0A8I5QKW0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5QL00", "url": "https://www.uniprot.org/uniprot/A0A8I5QL00", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5QL00-1", "url": "https://www.uniprot.org/uniprot/A0A8I5QL00-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PJM8", "url": "https://www.uniprot.org/uniprot/E9PJM8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PJM8-1", "url": "https://www.uniprot.org/uniprot/E9PJM8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PKK4", "url": "https://www.uniprot.org/uniprot/E9PKK4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PKK4-1", "url": "https://www.uniprot.org/uniprot/E9PKK4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PL95", "url": "https://www.uniprot.org/uniprot/E9PL95", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PL95-1", "url": "https://www.uniprot.org/uniprot/E9PL95-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PLE0", "url": "https://www.uniprot.org/uniprot/E9PLE0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PLE0-1", "url": "https://www.uniprot.org/uniprot/E9PLE0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQA3", "url": "https://www.uniprot.org/uniprot/E9PQA3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQA3-1", "url": "https://www.uniprot.org/uniprot/E9PQA3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V1A9", "url": "https://www.uniprot.org/uniprot/G3V1A9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V1A9-1", "url": "https://www.uniprot.org/uniprot/G3V1A9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P42695-1", "url": "https://www.uniprot.org/uniprot/P42695-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVALRGLGSGLQPWCPLDLRLEWVDTVWELDFTETEPLDPSIEAEIIETGLAAFTKLYESLLPFATGEHGSMESIWTFFIENNVSHSTLVALFYHFVQIVHKKNVSVQYREYGLHAAGLYFLLLEVPGSVANQVFHPVMFDKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRGKPPRREDIEMDEIIEEQEDENICFSARDLSQIRNAIFHLLKNFLRLLPKFSLKEKPQCVQNCIEVFVSLTNFEPVLHECHVTQARALNQAKYIPELAYYGLYLLCSPIHGEGDKVISCVFHQMLSVILMLEVGEGSHRAPLAVTSQVINCRNQAVQFISALVDELKESIFPVVRILLQHICAKVVDKSEYRTFAAQSLVQLLSKLPCGEYAMFIAWLYKYSRSSKIPHRVFTLDVVLALLELPEREVDNTLSLEHQKFLKHKFLVQEIMFDRCLDKAPTVRSKALSSFAHCLELTVTSASESILELLINSPTFSVIESHPGTLLRNSSAFSYQRQTSNRSEPSGEINIDSSGETVGSGERCVMAMLRRRIRDEKTNVRKSALQVLVSILKHCDVSGMKEDLWILQDQCRDPAVSVRKQALQSLTELLMAQPRCVQIQKAWLRGVVPVVMDCESTVQEKALEFLDQLLLQNIRHHSHFHSGDDSQVLAWALLTLLTTESQELSRYLNKAFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCKLNGFQWSLEVISSAVDALQRLCRASAETPAEEQELLTQVCGDVLSTCEHRLSNIVLKENGTGNMDEDLLVKYIFTLGDIAQLCPARVEKRIFLLIQSVLASSADADHSPSSQGSSEAPASQPPPQVRGSVMPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVCEDVAVRNNVIIVMCDLCIRYTIMVDKYIPNISMCLKDSDPFIRKQTLILLTNLLQEEFVKWKGSLFFRFVSTLIDSHPDIASFGEFCLAHLLLKRNPVMFFQHFIECIFHFNNYEKHEKYNKFPQSEREKRLFSLKGKSNKERRMKIYKFLLEHFTDEQRFNITSKICLSILACFADGILPLDLDASELLSDTFEVLSSKEIKLLAMRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPEKSISDVTFGAGVSYIGTPRTPSSAKEKIEGRSQGNDILCLSLPDKPPPQPQQWNVRSPARNKDTPACSRRSLRKTPLKTAN", "length": 1498, "header": "sp|P42695-1|CNDD3_HUMAN Isoform 1 of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2 CANONICAL=P42695-1" }, "isoforms": [ { "isoform_ac": "A0A8I5KR13-1", "url": "", "sequence": { "sequence": "MVALRGLGSGLQPWCPLDLRLEWVDTVWELDFTETEPLDPSIEAEIIETGLAAFTKLYESLLPFATGEHGSMEAV", "length": 75, "header": "tr|A0A8I5KR13-1|CNDD3_HUMAN Computationally mapped isoform of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134223926, "end_pos": 134210449, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000690743.1", "url": "https://www.ensembl.org/id/ENST00000690743.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000508701.1", "url": "https://www.ensembl.org/id/ENSP00000508701.1" } ] } }, { "isoform_ac": "A0A8I5KRL1-1", "url": "", "sequence": { "sequence": "XPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPEKSISDVTFGAGVSYIGTPRTPSSAKGAQSWDATWKTPVSLQCPPESCAG", "length": 122, "header": "tr|A0A8I5KRL1-1|A0A8I5KRL1_HUMAN Computationally mapped isoform of Non-SMC condensin II complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134158067, "end_pos": 134150511, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000526787.3", "url": "https://www.ensembl.org/id/ENST00000526787.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000509095.1", "url": "https://www.ensembl.org/id/ENSP00000509095.1" } ] } }, { "isoform_ac": "A0A8I5KT00-1", "url": "", "sequence": { "sequence": "MVALRGLGSGLQPWCPLDLRLEWVDTVWELDFTETEPLDPSIEAEIIETGLAAFTKLYESLLPFATGEHGSMESIWTFFIENNVSHSTLVALFYHFVQIVHKKNVSVQYREYGLHAAGLYFLLLEVPGSVANQVFHPVMFDKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRGKPPRREDIEMDEIIEEQEDENICFSARDLSQIRNAIFHLLKNFLRLLPKFSLKEKPQCVQNCIEVFVSLTNFEPVLHECHVTQARALNQAKYIPELAYYGLYLLCSPIHGEGDKVISCVFHQMLSVILMLEVGEGSHRAPLAVTSQVINCRNQAVQFISALVDELKESIFPVVRILLQHICAKVVDKSEYRTFAAQSLVQLLSKLPCGEYAMFIAWLYKYSRSSKIPHRVFTLDVVLALLELPEREVDNTLSLEHQKFLKHKFLVQEIMFDRCLDKAPTVRSKALSSFAHCLELTVTSASESILELLINSPTFSVIESHPGTLLRNSSAFSYQRQTSNRSEPSGEINIDSSGETVGSGERCVMAMLRRRIRDEKTNVRKSALQVLVSILKHCDVSGMKEDLWILQDQCRDPAVSVRKQALQSLTELLMAQPRCVQIQKAWLRGVVPVVMDCESTVQEKALEFLDQLLLQNIRHHSHFHSGDDSQVLAWALLTLLTTESQELSRYLNKAFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCKLNGFQWSLEVISSAVDALQRLCRASAETPAEEQELLTQVCGDVLSTCEHRLSNIVLKENGTGNMDEDLLVKYIFTLGDIAQLCPARVEKRIFLLIQSVLASSADADHSPSSQGSSEAPASQPPPQVRGSVMPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVCEDVAVRNNVIIVMCDLCIRYTIMVDKYIPNISMCLKDSDPFIRKQTLILLTNLLQEEFVKWKGSLFFRFVSTLIDSHPDIASFGEFCLAHLLLKRNPVMFFQHFIECIFHFNNYEKHEKYNKFPQSEREKRLFSLKGKSNKERRMKIYKFLLEHFTDEQRFNITSKICLSILACFADGILPLDLDASELLSDTFEVLSSKEIKLLAMRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPEKSISDVTFGAGVSYIGTPRTPSSAKEKIEGRSQGNDILCLSLPDKPNKDTPACSRRSLRKTPLKTAN", "length": 1484, "header": "tr|A0A8I5KT00-1|A0A8I5KT00_HUMAN Computationally mapped isoform of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134223926, "end_pos": 134152947, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000688263.1", "url": "https://www.ensembl.org/id/ENST00000688263.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000510008.1", "url": "https://www.ensembl.org/id/ENSP00000510008.1" } ] } }, { "isoform_ac": "A0A8I5KTC8-1", "url": "", "sequence": { "sequence": "ELLTQVCGDVLSTCEHRLSNIVLKENGTGNMDEDLLWSTSFLCSVSACWPSSPNAQ", "length": 56, "header": "tr|A0A8I5KTC8-1|CNDD3_HUMAN Computationally mapped isoform of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134181184, "end_pos": 134180275, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000693576.1", "url": "https://www.ensembl.org/id/ENST00000693576.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000510317.1", "url": "https://www.ensembl.org/id/ENSP00000510317.1" } ] } }, { "isoform_ac": "A0A8I5KTD5-1", "url": "", "sequence": { "sequence": "MVALRGLGSGLQPWCPLDLRLEWVDTVWELDFTETEPLDPSIEAEIIETGLAAFTKLYESLLPFATGEHGSMELSWCTVHREYNMSNIKNVVNLLEYPKSFPPKASRVSGPSSLRTMFPIVHWWHCSIILFK", "length": 132, "header": "tr|A0A8I5KTD5-1|CNDD3_HUMAN Computationally mapped isoform of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134223926, "end_pos": 134217023, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000689205.1", "url": "https://www.ensembl.org/id/ENST00000689205.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000510550.1", "url": "https://www.ensembl.org/id/ENSP00000510550.1" } ] } }, { "isoform_ac": "A0A8I5KYN6-1", "url": "", "sequence": { "sequence": "XPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPETRMLQSLAGNQQARVEVQRQGVEVSSGNLESISDVTFGAGVSYIGTPRTPSSAKEKIEGRSQGNDILCLSLPDKPPPQPQQWNVRSPARNKDTPACSRRSLRKTPLKTAN", "length": 183, "header": "tr|A0A8I5KYN6-1|CNDD3_HUMAN Computationally mapped isoform of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134158067, "end_pos": 134152945, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000691025.1", "url": "https://www.ensembl.org/id/ENST00000691025.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000509988.1", "url": "https://www.ensembl.org/id/ENSP00000509988.1" } ] } }, { "isoform_ac": "A0A8I5QKI5-1", "url": "", "sequence": { "sequence": "XSVANQVFHPVMFDKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRGKPPRREDIEMDEIIEEQEDENICFSARDLSQIRNAIFHLLKNFLRLLPKFSLKEKPQCVQNCIESS", "length": 119, "header": "tr|A0A8I5QKI5-1|A0A8I5QKI5_HUMAN Computationally mapped isoform of Non-SMC condensin II complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134210454, "end_pos": 134208945, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000690149.1", "url": "https://www.ensembl.org/id/ENST00000690149.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000508431.1", "url": "https://www.ensembl.org/id/ENSP00000508431.1" } ] } }, { "isoform_ac": "A0A8I5QKQ4-1", "url": "", "sequence": { "sequence": "XPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPEKSISDVTFGAGVSYIGTPRTPSSAKEKIEGRSQGNDILCLSLPDKPSPKLGRYMEDTSVPAVPT", "length": 137, "header": "tr|A0A8I5QKQ4-1|CNDD3_HUMAN Computationally mapped isoform of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134158067, "end_pos": 134150527, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000686368.1", "url": "https://www.ensembl.org/id/ENST00000686368.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000509165.1", "url": "https://www.ensembl.org/id/ENSP00000509165.1" } ] } }, { "isoform_ac": "A0A8I5QKW0-1", "url": "", "sequence": { "sequence": "XALNQAKYIPELAYYGLYLLCSPIHGEGDKVISCVFHQMLSVILMLEVGEGSHRAPLAVTSQVINCRNQAVQFISALVDELKESIFPVVRILLQHICAKVVDKSEYRTFAAQSLVQLLSKLPCGEYAMFIAWLYKYSRSSKIPHRVFTLDVVLALLELPEREVDNTLSLEHQKFLKHKFLVQEIMFDRCLDKAPTVRSKALSSFAHCLELTVTSASESILELLINSPTFSVIESHPGTLLRNSSAFSYQRQTSNRSEPSGEINIDSSGETVGSGDVSWQC", "length": 280, "header": "tr|A0A8I5QKW0-1|A0A8I5QKW0_HUMAN Computationally mapped isoform of Non-SMC condensin II complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134208951, "end_pos": 134194716, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000689387.1", "url": "https://www.ensembl.org/id/ENST00000689387.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000509764.1", "url": "https://www.ensembl.org/id/ENSP00000509764.1" } ] } }, { "isoform_ac": "A0A8I5QL00-1", "url": "", "sequence": { "sequence": "XSVANQVFHPVMFDKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRGKPPRREDIEMDEIIEEQEDENICFSARDLSQIRNAIFHLLKNFLRLLPKFSLKEKPQCVQNCIEAFSSYLFSRSLFH", "length": 130, "header": "tr|A0A8I5QL00-1|A0A8I5QL00_HUMAN Computationally mapped isoform of Non-SMC condensin II complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134210454, "end_pos": 134209193, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000687965.1", "url": "https://www.ensembl.org/id/ENST00000687965.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000510259.1", "url": "https://www.ensembl.org/id/ENSP00000510259.1" } ] } }, { "isoform_ac": "E9PJM8-1", "url": "", "sequence": { "sequence": "MVALRGLGSGLQPWCPLDLRLGSTGCLTCRHHQTSHE", "length": 37, "header": "tr|E9PJM8-1|CNDD3_HUMAN Computationally mapped isoform of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134223926, "end_pos": 134223436, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000526422.2", "url": "https://www.ensembl.org/id/ENST00000526422.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000435586.1", "url": "https://www.ensembl.org/id/ENSP00000435586.1" } ] } }, { "isoform_ac": "E9PKK4-1", "url": "", "sequence": { "sequence": "MVALRGLGSGLQPWCPLDLRLEWVDTVWELDFTETEPLDPSIEAEIIETGLAAFTKLYESLLPFATGEHGSMESIWTFFIENNVSHSTLVALFYHFVQIVHKKNVSVQYREYGLHAAGLYFLLLEVPGSVANQVFHPVMFDKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRGKPPRREDIEMDEIIEEQEDENICFSARDLSQIRNAIFHLLKNFLRLLPKFSLKEKPQCVQNCIEVFVSLTNFEPVLHECHVTQARALNQAKYIPELAYYGLYLLCSPIHGEGDKVISCVFHQMLSVILMLEVGEGSHRAPLAVTSQVINCRNQAVQFISALVDELKESIFPVVRILLQHICAKVVDKSEYRTFAAQSLVQLLSKLPCGEYAMFIAWLYKYSRSSKIPHRVFTLDVVLALLELPEREVDNTLSLEHQKFLKHKFLVQEIMFDRCLDKAPTVRSKALSSFAHCLELTVTSASESILELLINSPTFSVIESHPGTLLRNSSAFSYQRQTSNRSEPSGEINIDSSGETVGSGERCVMAMLRRRIRDEKTNVRKSALQVLVSILKHCDVSGMKEDLWILQDQCRDPAVSVRKQALQSLTELLMAQPRCVQIQKAWLRGVVPVVMDCESTVQEKALEFLDQLLLQNIRHHSHFHSGDDSQVLAWALLTLLTTESQELSRYLNKAFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCKLNGFQWSLEVISSAVDALQRLCRASAETPAEEQHWLEKESCVQRAVRA", "length": 832, "header": "tr|E9PKK4-1|E9PKK4_HUMAN Computationally mapped isoform of Non-SMC condensin II complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134223926, "end_pos": 134183109, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000525964.7", "url": "https://www.ensembl.org/id/ENST00000525964.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000431612.2", "url": "https://www.ensembl.org/id/ENSP00000431612.2" } ] } }, { "isoform_ac": "E9PL95-1", "url": "", "sequence": { "sequence": "XSVANQVFHPVMFDKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRGKPPRREDIEVRNG", "length": 66, "header": "tr|E9PL95-1|E9PL95_HUMAN Computationally mapped isoform of Non-SMC condensin II complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134210454, "end_pos": 134209472, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000533155.6", "url": "https://www.ensembl.org/id/ENST00000533155.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000431413.2", "url": "https://www.ensembl.org/id/ENSP00000431413.2" } ] } }, { "isoform_ac": "E9PLE0-1", "url": "", "sequence": { "sequence": "VKYIFTLGDIAQLCPARVEKRIFLLIQSVLASSADADHSPSSQGSSEAPASQPPPQVRGSVMPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVCEDVAVRNNVIIVMCDLCIRYTIMVDKYIPNISMCLKDSDPFIRKQTLILLTNLLQEEFVKWKGSLFFRFVSTLIDSHPDIASFGEFCLAHLLLKRNPVMFFQHFIECIFHFNNYEKHEKYNKFPQSEREKRLFSLKGKSNKERRMKIYKFLLEHFTDEQRFNITSKICLSILACFADGILPLDLDASELLSDTFEVLSSKEIKLLAMRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPER", "length": 565, "header": "tr|E9PLE0-1|E9PLE0_HUMAN Computationally mapped isoform of Non-SMC condensin II complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134178936, "end_pos": 134156921, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000530396.2", "url": "https://www.ensembl.org/id/ENST00000530396.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000435173.2", "url": "https://www.ensembl.org/id/ENSP00000435173.2" } ] } }, { "isoform_ac": "E9PQA3-1", "url": "", "sequence": { "sequence": "XCFADGILPLDLDASELLSDTFEVLSSKEIKLLAMRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPEMSLHSVSQTPQWPAEQTMPLRHREHQ", "length": 319, "header": "tr|E9PQA3-1|CNDD3_HUMAN Computationally mapped isoform of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=9 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134168195, "end_pos": 134153353, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000527944.2", "url": "https://www.ensembl.org/id/ENST00000527944.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000432532.2", "url": "https://www.ensembl.org/id/ENSP00000432532.2" } ] } }, { "isoform_ac": "G3V1A9-1", "url": "", "sequence": { "sequence": "MVALRGLGSGLQPWCPLDLRLEWVDTVWELDFTETEPLDPSIEAEIIETGLAAFTKLYESLLPFATGEHGSMESIWTFFIENNVSHSTLVALFYHFVQIVHKKNVSVQYREYGLHAAGLYFLLLEVPGSVANQVFHPVMFDKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRGKPPRREDIEMDEIIEEQEDENICFSARDLSQIRNAIFHLLKNFLRLLPKFSLKEKPQCVQNCIEVFVSLTNFEPVLHECHVTQARALNQAKYIPELAYYGLYLLCSPIHGEGDKVISCVFHQMLSVILMLEVGEGSHRAPLAVTSQVINCRNQAVQFISALVDELKESIFPVVRILLQHICAKVVDKSEYRTFAAQSLVQLLSKLPCGEYAMFIAWLYKYSRSSKIPHRVFTLDVVLALLELPEREVDNTLSLEHQKFLKHKFLVQEIMFDRCLDKAPTVRSKALSSFAHCLELTVTSASESILELLINSPTFSVIESHPGTLLRNSSAFSYQRQTSNRSEPSGEINIDSSGETVGSGERCVMAMLRRRIRDEKTNVRKSALQVLVSILKHCDVSGMKEDLWILQDQCRDPAVSVRKQALQSLTELLMAQPRCVQIQKAWLRGVVPVVMDCESTVQEKALEFLDQLLLQNIRHHSHFHSGDDSQVLAWALLTLLTTESQELSRYLNKAFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCKLNGFQWSLEVISSAVDALQRLCRASAETPAEEQELLTQVCGDVLSTCEHRLSNIVLKENGTGNMDEDLLVKYIFTLGDIAQLCPARVEKRIFLLIQSVLASSADADHSPSSQGSSEAPASQPPPQVRGSVMPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVCEDVAVRNNVIIVMCDLCIRYTIMVDKYIPNISMCLKDSDPFIRKQTLILLTNLLQEEFVKWKGSLFFRFVSTLIDSHPDIASFGEFCLAHLLLKRNPVMFFQHFIECIFHFNNYEKHEKYNKFPQSERALHR", "length": 1084, "header": "tr|G3V1A9-1|CNDD3_HUMAN Computationally mapped isoform of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=1 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134223926, "end_pos": 134168516, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000534532.7", "url": "https://www.ensembl.org/id/ENST00000534532.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000434168.2", "url": "https://www.ensembl.org/id/ENSP00000434168.2" } ] } }, { "isoform_ac": "P42695-1", "url": "", "sequence": { "sequence": "MVALRGLGSGLQPWCPLDLRLEWVDTVWELDFTETEPLDPSIEAEIIETGLAAFTKLYESLLPFATGEHGSMESIWTFFIENNVSHSTLVALFYHFVQIVHKKNVSVQYREYGLHAAGLYFLLLEVPGSVANQVFHPVMFDKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRGKPPRREDIEMDEIIEEQEDENICFSARDLSQIRNAIFHLLKNFLRLLPKFSLKEKPQCVQNCIEVFVSLTNFEPVLHECHVTQARALNQAKYIPELAYYGLYLLCSPIHGEGDKVISCVFHQMLSVILMLEVGEGSHRAPLAVTSQVINCRNQAVQFISALVDELKESIFPVVRILLQHICAKVVDKSEYRTFAAQSLVQLLSKLPCGEYAMFIAWLYKYSRSSKIPHRVFTLDVVLALLELPEREVDNTLSLEHQKFLKHKFLVQEIMFDRCLDKAPTVRSKALSSFAHCLELTVTSASESILELLINSPTFSVIESHPGTLLRNSSAFSYQRQTSNRSEPSGEINIDSSGETVGSGERCVMAMLRRRIRDEKTNVRKSALQVLVSILKHCDVSGMKEDLWILQDQCRDPAVSVRKQALQSLTELLMAQPRCVQIQKAWLRGVVPVVMDCESTVQEKALEFLDQLLLQNIRHHSHFHSGDDSQVLAWALLTLLTTESQELSRYLNKAFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCKLNGFQWSLEVISSAVDALQRLCRASAETPAEEQELLTQVCGDVLSTCEHRLSNIVLKENGTGNMDEDLLVKYIFTLGDIAQLCPARVEKRIFLLIQSVLASSADADHSPSSQGSSEAPASQPPPQVRGSVMPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVCEDVAVRNNVIIVMCDLCIRYTIMVDKYIPNISMCLKDSDPFIRKQTLILLTNLLQEEFVKWKGSLFFRFVSTLIDSHPDIASFGEFCLAHLLLKRNPVMFFQHFIECIFHFNNYEKHEKYNKFPQSEREKRLFSLKGKSNKERRMKIYKFLLEHFTDEQRFNITSKICLSILACFADGILPLDLDASELLSDTFEVLSSKEIKLLAMRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPEKSISDVTFGAGVSYIGTPRTPSSAKEKIEGRSQGNDILCLSLPDKPPPQPQQWNVRSPARNKDTPACSRRSLRKTPLKTAN", "length": 1498, "header": "sp|P42695-1|CNDD3_HUMAN Isoform 1 of Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2 CANONICAL=P42695-1" }, "locus": { "chromosome": "11", "start_pos": 134223926, "end_pos": 134152947, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000688672.1", "url": "https://www.ensembl.org/id/ENST00000688672.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000510391.1", "url": "https://www.ensembl.org/id/ENSP00000510391.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 1250, "end_pos": 1250, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser1250" }, { "start_pos": 1321, "end_pos": 1321, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P42695", "url": "http://phospho.elm.eu.org/byAccession/P42695.html" } ], "site_lbl": "Ser1321" }, { "start_pos": 1328, "end_pos": 1328, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser1328" }, { "start_pos": 1329, "end_pos": 1329, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P42695", "url": "http://phospho.elm.eu.org/byAccession/P42695.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser1329" }, { "start_pos": 1331, "end_pos": 1331, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P42695", "url": "http://phospho.elm.eu.org/byAccession/P42695.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Thr1331" }, { "start_pos": 1334, "end_pos": 1334, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "phospho.ELM", "id": "P42695", "url": "http://phospho.elm.eu.org/byAccession/P42695.html" } ], "site_lbl": "Thr1334" }, { "start_pos": 1348, "end_pos": 1348, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P42695", "url": "http://phospho.elm.eu.org/byAccession/P42695.html" } ], "site_lbl": "Ser1348" }, { "start_pos": 1350, "end_pos": 1350, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P42695", "url": "http://phospho.elm.eu.org/byAccession/P42695.html" } ], "site_lbl": "Ser1350" }, { "start_pos": 1351, "end_pos": 1351, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr1351" }, { "start_pos": 1357, "end_pos": 1357, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1357" }, { "start_pos": 1370, "end_pos": 1370, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser1370" }, { "start_pos": 1372, "end_pos": 1372, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P42695", "url": "http://phospho.elm.eu.org/byAccession/P42695.html" } ], "site_lbl": "Ser1372" }, { "start_pos": 1379, "end_pos": 1379, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Thr1379" }, { "start_pos": 1382, "end_pos": 1382, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ], "site_lbl": "Ser1382" }, { "start_pos": 1384, "end_pos": 1384, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "P42695", "url": "http://phospho.elm.eu.org/byAccession/P42695.html" } ], "site_lbl": "Ser1384" }, { "start_pos": 1393, "end_pos": 1393, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P42695", "url": "http://phospho.elm.eu.org/byAccession/P42695.html" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ], "site_lbl": "Ser1393" }, { "start_pos": 1415, "end_pos": 1415, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "21498573", "url": "https://glygen.org/publication/PubMed/21498573" }, { "database": "PRO", "id": "P42695", "url": "http://purl.obolibrary.org/obo/P42695" } ], "site_lbl": "Thr1415" }, { "start_pos": 1419, "end_pos": 1419, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "P42695", "url": "http://purl.obolibrary.org/obo/P42695" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "site_lbl": "Ser1419" }, { "start_pos": 430, "end_pos": 430, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Thr430" }, { "start_pos": 507, "end_pos": 507, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser507" }, { "start_pos": 508, "end_pos": 508, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser508" }, { "start_pos": 531, "end_pos": 531, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "phospho.ELM", "id": "P42695", "url": "http://phospho.elm.eu.org/byAccession/P42695.html" } ], "site_lbl": "Ser531" }, { "start_pos": 567, "end_pos": 567, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "site_lbl": "Ser567" }, { "start_pos": 895, "end_pos": 895, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "18077418", "url": "https://glygen.org/publication/PubMed/18077418" } ], "site_lbl": "Ser895" }, { "start_pos": 972, "end_pos": 972, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ], "site_lbl": "Tyr972" } ], "glycation": [], "keywords": [], "publication": [ { "title": "PR-Set7 is a nucleosome-specific methyltransferase that modifies lysine 20 of histone H4 and is associated with silent chromatin.", "journal": "Molecular cell", "date": "2002", "authors": "Nishioka K, Rice JC, Sarma K, Erdjument-Bromage H, Werner J, Wang Y, Chuikov S, Valenzuela P, Tempst P, Steward R, Lis JT, Allis CD, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "12086618", "url": "https://glygen.org/publication/PubMed/12086618" } ] }, { "title": "Mitotic-specific methylation of histone H4 Lys 20 follows increased PR-Set7 expression and its localization to mitotic chromosomes.", "journal": "Genes & development", "date": "2002", "authors": "Rice JC, Nishioka K, Sarma K, Steward R, Reinberg D, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "12208845", "url": "https://glygen.org/publication/PubMed/12208845" } ] }, { "title": "Differential contributions of condensin I and condensin II to mitotic chromosome architecture in vertebrate cells.", "journal": "Cell", "date": "2003", "authors": "Ono T, Losada A, Hirano M, Myers MP, Neuwald AF, Hirano T", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "RefSeq", "id": "NP_056076", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076" } ], "reference": [ { "type": "PubMed", "id": "14532007", "url": "https://glygen.org/publication/PubMed/14532007" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "Role of the RB1 family in stabilizing histone methylation at constitutive heterochromatin.", "journal": "Nature cell biology", "date": "2005", "authors": "Gonzalo S, Garcia-Cao M, Fraga MF, Schotta G, Peters AH, Cotter SE, Eguia R, Dean DC, Esteller M, Jenuwein T, Blasco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "15750587", "url": "https://glygen.org/publication/PubMed/15750587" } ] }, { "title": "Phosphoproteome analysis of the human mitotic spindle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Profiling of UV-induced ATM/ATR signaling pathways.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Stokes MP, Rush J, Macneill J, Ren JM, Sprott K, Nardone J, Yang V, Beausoleil SA, Gygi SP, Livingstone M, Zhang H, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "18077418", "url": "https://glygen.org/publication/PubMed/18077418" } ] }, { "title": "Loss of RB1 induces non-proliferative retinoma: increasing genomic instability correlates with progression to retinoblastoma.", "journal": "Human molecular genetics", "date": "2008", "authors": "Dimaras H, Khetan V, Halliday W, Orlic M, Prigoda NL, Piovesan B, Marrano P, Corson TW, Eagle RC Jr, Squire JA, Gallie BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "18211953", "url": "https://glygen.org/publication/PubMed/18211953" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "J. Proteome Res.", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "RBF1 promotes chromatin condensation through a conserved interaction with the Condensin II protein dCAP-D3.", "journal": "Genes & development", "date": "2008", "authors": "Longworth MS, Herr A, Ji JY, Dyson NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "18367646", "url": "https://glygen.org/publication/PubMed/18367646" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Mol. Cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Microcephalin/MCPH1 associates with the Condensin II complex to function in homologous recombination repair.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wood JL, Liang Y, Li K, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "18718915", "url": "https://glygen.org/publication/PubMed/18718915" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative analysis of the human spindle phosphoproteome at distinct mitotic stages.", "journal": "Journal of proteome research", "date": "2009", "authors": "Malik R, Lenobel R, Santamaria A, Ries A, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Loss of pRB causes centromere dysfunction and chromosomal instability.", "journal": "Genes & development", "date": "2010", "authors": "Manning AL, Longworth MS, Dyson NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20551165", "url": "https://glygen.org/publication/PubMed/20551165" } ] }, { "title": "Mitotic chromosome condensation mediated by the retinoblastoma protein is tumor-suppressive.", "journal": "Genes & development", "date": "2010", "authors": "Coschi CH, Martens AL, Ritchie K, Francis SM, Chakrabarti S, Berube NG, Dick FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20551166", "url": "https://glygen.org/publication/PubMed/20551166" } ] }, { "title": "PHF8 mediates histone H4 lysine 20 demethylation events involved in cell cycle progression.", "journal": "Nature", "date": "2010", "authors": "Liu W, Tanasa B, Tyurina OV, Zhou TY, Gassmann R, Liu WT, Ohgi KA, Benner C, Garcia-Bassets I, Aggarwal AK, Desai A, Dorrestein PC, Glass CK, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20622854", "url": "https://glygen.org/publication/PubMed/20622854" } ] }, { "title": "Dynamic regulation of the PR-Set7 histone methyltransferase is required for normal cell cycle progression.", "journal": "Genes & development", "date": "2010", "authors": "Wu S, Wang W, Kong X, Congdon LM, Yokomori K, Kirschner MW, Rice JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20966048", "url": "https://glygen.org/publication/PubMed/20966048" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "The initial phase of chromosome condensation requires Cdk1-mediated phosphorylation of the CAP-D3 subunit of condensin II.", "journal": "Genes & development", "date": "2011", "authors": "Abe S, Nagasaka K, Hirayama Y, Kozuka-Hata H, Oyama M, Aoyagi Y, Obuse C, Hirota T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "21498573", "url": "https://glygen.org/publication/PubMed/21498573" } ] }, { "title": "SET nuclear oncogene associates with microcephalin/MCPH1 and regulates chromosome condensation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Leung JW, Leitch A, Wood JL, Shaw-Smith C, Metcalfe K, Bicknell LS, Jackson AP, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "21515671", "url": "https://glygen.org/publication/PubMed/21515671" } ] }, { "title": "MCPH1 regulates chromosome condensation and shaping as a composite modulator of condensin II.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Yamashita D, Shintomi K, Ono T, Gavvovidis I, Schindler D, Neitzel H, Trimborn M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "21911480", "url": "https://glygen.org/publication/PubMed/21911480" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" }, { "database": "iPTMnet", "id": "P42695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42695" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Characterisation of retinoblastomas without RB1 mutations: genomic, gene expression, and clinical studies.", "journal": "The Lancet. Oncology", "date": "2013", "authors": "Rushlow DE, Mol BM, Kennett JY, Yee S, Pajovic S, Theriault BL, Prigoda-Lee NL, Spencer C, Dimaras H, Corson TW, Pang R, Massey C, Godbout R, Jiang Z, Zacksenhaus E, Paton K, Moll AC, Houdayer C, Raizis A, Halliday W, Lam WL, Boutros PC, Lohmann D, Dorsman JC, Gallie BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "23498719", "url": "https://glygen.org/publication/PubMed/23498719" } ] }, { "title": "The bromodomain protein Brd4 insulates chromatin from DNA damage signalling.", "journal": "Nature", "date": "2013", "authors": "Floyd SR, Pacold ME, Huang Q, Clarke SM, Lam FC, Cannell IG, Bryson BD, Rameseder J, Lee MJ, Blake EJ, Fydrych A, Ho R, Greenberger BA, Chen GC, Maffa A, Del Rosario AM, Root DE, Carpenter AE, Hahn WC, Sabatini DM, Chen CC, White FM, Bradner JE, Yaffe MB", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "reference": [ { "type": "PubMed", "id": "23728299", "url": "https://glygen.org/publication/PubMed/23728299" } ] }, { "title": "Mutations in genes encoding condensin complex proteins cause microcephaly through decatenation failure at mitosis.", "journal": "Genes Dev.", "date": "2016", "authors": "Martin CA, Murray JE, Carroll P, Leitch A, Mackenzie KJ, Halachev M, Fetit AE, Keith C, Bicknell LS, Fluteau A, Gautier P, Hall EA, Joss S, Soares G, Silva J, Bober MB, Duker A, Wise CA, Quigley AJ, Phadke SR, Wood AJ, Vagnarelli P, Jackson AP", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "reference": [ { "type": "PubMed", "id": "27737959", "url": "https://glygen.org/publication/PubMed/27737959" } ] }, { "title": "Condensin II and GAIT complexes cooperate to restrict LINE-1 retrotransposition in epithelial cells.", "journal": "PLoS genetics", "date": "2017", "authors": "Ward JR, Vasu K, Deutschman E, Halawani D, Larson PA, Zhang D, Willard B, Fox PL, Moran JV, Longworth MS", "evidence": [ { "database": "RefSeq", "id": "NP_056076", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076" } ], "reference": [ { "type": "PubMed", "id": "29028794", "url": "https://glygen.org/publication/PubMed/29028794" } ] }, { "title": "Non-SMC condensin I complex subunit D2 and non-SMC condensin II complex subunit D3 induces inflammation via the IKK/NF-kappaB pathway in ulcerative colitis.", "journal": "World journal of gastroenterology", "date": "2019", "authors": "Yuan CW, Sun XL, Qiao LC, Xu HX, Zhu P, Chen HJ, Yang BL", "evidence": [ { "database": "RefSeq", "id": "NP_056076", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076" } ], "reference": [ { "type": "PubMed", "id": "31885422", "url": "https://glygen.org/publication/PubMed/31885422" } ] }, { "title": "NCAPD3 promotes prostate cancer progression by up-regulating EZH2 and MALAT1 through STAT3 and E2F1.", "journal": "Cellular signalling", "date": "2022", "authors": "Jing Z, Liu Q, Xie W, Wei Y, Liu J, Zhang Y, Zuo W, Lu S, Zhu Q, Liu P", "evidence": [ { "database": "RefSeq", "id": "NP_056076", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056076" } ], "reference": [ { "type": "PubMed", "id": "35085770", "url": "https://glygen.org/publication/PubMed/35085770" } ] } ], "pathway": [ { "id": "hsa:23310", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:23310", "resource": "KEGG Pathway" }, { "id": "R-HSA-2299718", "name": "Condensation of Prophase Chromosomes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718", "resource": "Reactome", "description": "Condensation of Prophase Chromosomes" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A140UHX3-1", "protein_name": "Condensin-2 complex subunit D3", "gene_name": "Ncapd3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVGMALKDLGRDLQPWCPLDLSLEWVNTVWDLDFTETEPLDPSVVAEILETGRDAFTKLYGSLFPFATDESGSLESVWSFFTENSISSNTLVALFCHFVQEAHKKSASVQYREYGLRAAGLYFLLLEIPGSVVNQVFHPVMFDKCIQILKKSWPQESNLTQKRKKEHSKSSKANYRRSRKRGKPPRKEDYQVDELSREEEEEEEEEIYFSVRDLSQIRDAIFNLLKNFLRLLPKFSLKEKPQSIQTCIEVFVALTSFEPIPHKFLISQARNLSEVKHISELAYYGLYLLCSPVHGEGNKVIGSIFHQMLNVILMLEVGEGSRCAPLAITSHVINCRNQAVQFVSSLVDELQESVFPILGTLLQHICAKVVDKAEYRTYAAQSLVQLLSKLPSKEYATFIAWLYKYSRSSKIPHRVFTLDVALALLELPERLLDDTVLLEHQKFLKHKFFVQEIIFDRCLDKAPTVRSKALSSFAQCLELSTSNTSENTLEIFINSTVTGIHSHFGTSLRPSTVLTSQSCRSVQSSTHDSDEQTPPGERRFMTMLRKRTKDEKINVRKSALQVLMSILKHCDILSMEEDLLILQDHCRDPAISVRKQALQSLTELVMAKPTCVPVQKAWLMGVIPVVMDYESTVQEKALECLDQLLLQNIKHHRKFHSEDRSQVLAWALLALLTVESQDLSRYLNKAFHIWSKKDKFSSTFINSVISHTDTERSAPAWMLLSKITCSSPKLDYTKIMESWEKLSREQSPNSNTLGYMLCVIGHIAKHLPKSTQDKITGVIKAKLNGFQWSLELISLSVDTLQGLCRASAKTLREEQELLKRVCGDVLSTCEQHLSNILLKEDGTGNMDEDLVVKCIFTLGDIAQLCPALVEKRVFLLIQSILASSAHADHLPSSQGTTDLASQLPFQARSSALPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVCEDVAVRNNVIIVMCDLCIRYTVMVDNYIPNISICLKDSDPFIRKQTLILLTNLLQEEYVKWKGSLFFRFVSTLVDSHPDIASLGEFCLAHLLLKRNPTMFFQHFIECIFHFNSYEKHGQYNKFSQSERGKPLFLLKGKTNKEKRMRIYKFLLEHFTDEQRFNVTSKICLNILACFTDGVLPVDMEASELLSDTFDILSSKEIKLLAMRAQASKELLEEDDVALANVVMQEAQMKIISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMNYLREVMQDYRDEIKDFFAVDRQLASELEYDMKKYTEQLAQEQALTEHANATNVPADGDRVPSQQVAPDLQAVPGAAAAAGAGQADANMPLPLAQSQPSAPGSSFTPTLPPICEKGPLKIMSSTRPMSLSTIAILNSVKKAVASKSRTRSLGALSFNMENGSPENPSSRASSLSLEQESERAVKRVTKRAISTPEKSISNVTFGAGVSYIGTPATSFFTKEKPEEAQEEGNDILCLSLLDKRPPQSPQWNVKSPARSQDNPRSGRRSLRKAPLKTAN", "length": 1497 }, "evidence": [ { "id": "45237894", "url": "http://www.informatics.jax.org/homology/45237894", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6ZQK0-1", "protein_name": "Condensin-2 complex subunit D3", "gene_name": "Ncapd3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALQDLGENLQPWCPLGLSLEWVKTVWDLDFTEIEPLDPSIVGEILETGRDAFTKLYGSLFPFATDESGSLESIWTFFTENDISSNTLVALFCHFVQEAHKKSASAQYREYGLHAAGLYFLLLEIPGIVVNQVFHPVMFDKCIQILKRSWPQESNLTQKRKKDHSKSSKDNYRKSRKRGKPPRKEDYQVDELSREEEEEEEEIYFSGRDLCQIRDAIFNLLKNFLRLLPKFSLKEKPQSIQTCIEVFVALTSFEPIPHKFLISQARNLNEVKHISELAYYGLYLLCSPVHGEENKVIGSIFHQMLNVILMLEVGEGSRCAPLAITSQVINCRNQAVQFVSSLVDELQASVYPVLGTLLQHICAKVVDKAEYRTYAAQSLVQLLTKLPSEEYATFIAWLYKYSRSSKIPHRVFTLDVALALLTLPERELDDTVSLEHQKFLKHKFFVQEIIFDRCLDKAPTVRSKALSSFAHCLELSSSNTSESILEIFINSNLVPGIQNLSNTVLNPSPVLTSRNGYSAQSRTHNNDEQTLPGERCFMTMLRKRIKDEKINVRKSALQVLMSILKHCDILSMEQDLLILQDHCRDPAISVRKQALQSLTELVMAQPTCVPVQKAWLMGVIPVVMDCESTVQEKALECLDQLLLQNIKHHKKFHSADRSQVLAWSLLALLTIENQDLRRYLNKAFHIWSKKDKFSSTFINSVISHTDTERSAPAWMLLSKITCSSPKLDYTKIIESWERLSREQSPNSNTLGYMLCVIGHIAKHLPKGTRDKITGVIKAKLNGFQWSPELISSSVDALQKLCRASAKTVLEEQGLLKQVCGDVLATCEQHLSNILLKEDGTGNMDEGLVVKCIFTLGDIAQLCPAIVEKRVFLLIQSILASSAHSDHLPSSQGTTDALDSQPPFQPRSSAMPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVSEDVAVRNNVIIVICDLCIRYTVMVDNYIPNISVCLKDSDPFIRKQTLVLLTNLLQEEYVKWKGSLFFRFVSTLVDSHPDIASLGEFCLAHLLLKRNPTMFFQHFIECIFHFNSYEKHGQYNKFSQSERGKQLFLLKGKTNKEKRMRIYKFLLEHFTDEQRFNVTSKICLNILACFTDGILPMDMEASELLSDTFDILNSKEIKLLAMRAQTSKDLLEEDDVALANVVMQEAQMKIISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMNYLREVMQDYRDEINDFFAVDKQLASELEYDMKKYNEQLAQEQALTEHANATKGPEDSDRVPSAQVAPDLEAVPALAAAPMAAAAAAAPMAAAAAAAGQDNADVPPTQSRPSAPRSNFTPTLPPISENGPLKIMSSTRPMSLSTIAILNSVKKAVASKNRTRSLGALPFNVETGSPENPSSHESSLSLEKESDRTVNHVTKRAISTPENSISDVTFAAGVSYIGTPATFFTKEKHEAQEQGSDILCLSLLDKRPPQSPQWNVKSPARSHGSTRSSRRSLRKAPLKTAN", "length": 1506 }, "evidence": [ { "id": "45237894", "url": "http://www.informatics.jax.org/homology/45237894", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "positive regulation of chromosome separation", "id": "GO:1905820", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905820", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "positive regulation of chromosome segregation", "id": "GO:0051984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051984", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "mitotic chromosome condensation", "id": "GO:0007076", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007076", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "meiotic chromosome condensation", "id": "GO:0010032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010032", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "positive regulation of chromosome condensation", "id": "GO:1905821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905821", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "condensed nuclear chromosome", "id": "GO:0000794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000794", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "condensin complex", "id": "GO:0000796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000796", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "condensed chromosome, centromeric region", "id": "GO:0000779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000779", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "pericentric heterochromatin", "id": "GO:0005721", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005721", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "histone binding", "id": "GO:0042393", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042393", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" }, { "name": "methylated histone binding", "id": "GO:0035064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035064", "evidence": [ { "database": "UniProtKB", "id": "P42695", "url": "https://www.uniprot.org/uniprot/P42695" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 104, "end_pos": 106, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1114, "end_pos": 1116, "annotation": "n_glycosylation_sequon" }, { "start_pos": 506, "end_pos": 508, "annotation": "n_glycosylation_sequon" }, { "start_pos": 518, "end_pos": 520, "annotation": "n_glycosylation_sequon" }, { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" }, { "start_pos": 843, "end_pos": 845, "annotation": "n_glycosylation_sequon" }, { "start_pos": 982, "end_pos": 984, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 25 }, { "field": "total_sites", "count": 25 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 38 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }