{ "uniprot_canonical_ac": "P41136-1", "uniprot_ac": "P41136", "uniprot_id": "ID2_MOUSE", "mass": { "chemical_mass": 14959.0, "monoisotopic_mass": 14959.0 }, "refseq": { "ac": "NP_034626", "name": "DNA-binding protein inhibitor ID-2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034626" }, "gene_names": [ { "name": "Id2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P41136", "id": "P41136" }, { "name": "Id-2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P41136", "id": "P41136" }, { "name": "Id2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034626", "id": "NP_034626" }, { "name": "Idb2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P41136", "id": "P41136" }, { "name": "bHLHb26; Idb2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034626", "id": "NP_034626" } ], "protein_names": [ { "name": "DNA-binding protein inhibitor ID-2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P41136" }, { "name": "DNA-binding protein inhibitor ID-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034626", "id": "NP_034626" }, { "name": "Inhibitor of DNA binding 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P41136" }, { "name": "Inhibitor of differentiation 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P41136" }, { "name": "inhibitor of differentiation 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034626", "id": "NP_034626" } ], "function": [ { "annotation": "Insulin Elevates ID2 Expression in Trophoblasts and Aggravates Preeclampsia in Obese ASB4-Null Mice. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_034626", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034626" }, { "database": "PubMed", "id": "36768469", "url": "https://glygen.org/publication/PubMed/36768469" } ] }, { "annotation": "Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer. Restricts the CLOCK and BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism.", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136#function" }, { "database": "PubMed", "id": "19217292", "url": "https://glygen.org/publication/PubMed/19217292" }, { "database": "PubMed", "id": "20861012", "url": "https://glygen.org/publication/PubMed/20861012" }, { "database": "PubMed", "id": "19740747", "url": "https://glygen.org/publication/PubMed/19740747" }, { "database": "PubMed", "id": "16556596", "url": "https://glygen.org/publication/PubMed/16556596" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Id2", "url": "https://www.uniprot.org/uniprot/P41136", "locus": { "chromosome": "12", "start_pos": 25143798, "end_pos": 25147139, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020644", "url": "https://www.ensembl.org/id/ENSMUSG00000020644" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020644", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020644", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd19692", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19692", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "15902", "url": "https://www.ncbi.nlm.nih.gov/gene/15902", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P41136", "url": "https://www.ebi.ac.uk/intact/interactors/id:P41136*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR011598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026052", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026052", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036638", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036638", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:15902", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15902", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "96397", "url": "http://www.informatics.jax.org/marker/MGI:96397", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "TPEFQSD", "url": "https://omabrowser.org/oma/group/TPEFQSD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4207391at2759", "url": "http://www.orthodb.org/?query=4207391at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11723", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11723", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11723:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11723:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00010", "url": "http://pfam.xfam.org/family/PF00010", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P41136", "url": "http://purl.obolibrary.org/obo/PR_P41136", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_034626", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034626", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1Y7VMT3", "url": "https://www.uniprot.org/uniprot/A0A1Y7VMT3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1Y7VMT3-1", "url": "https://www.uniprot.org/uniprot/A0A1Y7VMT3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P41136-1", "url": "https://www.uniprot.org/uniprot/P41136-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG", "length": 134, "header": "sp|P41136-1|ID2_MOUSE Isoform 1 of DNA-binding protein inhibitor ID-2 OS=Mus musculus OX=10090 GN=Id2 PE=1 SV=3 CANONICAL=P41136-1" }, "isoforms": [ { "isoform_ac": "A0A1Y7VMT3-1", "url": "", "sequence": { "sequence": "MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQVRLACKYATAQTLRVSRAVTLKAHRRDRFINFIFEETVY", "length": 155, "header": "tr|A0A1Y7VMT3-1|ID2_MOUSE Computationally mapped isoform of DNA-binding protein inhibitor ID-2 OS=Mus musculus OX=10090 GN=Id2 PE=1 SV=1 CANONICAL=P41136-1" }, "locus": { "chromosome": "12", "start_pos": 25146009, "end_pos": 25145545, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000222667.2", "url": "https://www.ensembl.org/id/ENSMUST00000222667.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000152069.2", "url": "https://www.ensembl.org/id/ENSMUSP00000152069.2" } ] } }, { "isoform_ac": "P41136-1", "url": "", "sequence": { "sequence": "MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG", "length": 134, "header": "sp|P41136-1|ID2_MOUSE Isoform 1 of DNA-binding protein inhibitor ID-2 OS=Mus musculus OX=10090 GN=Id2 PE=1 SV=3 CANONICAL=P41136-1" }, "locus": { "chromosome": "12", "start_pos": 25146009, "end_pos": 25145320, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000020974", "url": "https://www.ensembl.org/id/ENSMUST00000020974" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000020974", "url": "https://www.ensembl.org/id/ENSMUSP00000020974" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "site_lbl": "Ser14" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "P41136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P41136" } ], "site_lbl": "Ser25" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P41136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P41136" }, { "database": "PubMed", "id": "19609365", "url": "https://glygen.org/publication/PubMed/19609365" }, { "database": "PubMed", "id": "21947283", "url": "https://glygen.org/publication/PubMed/21947283" } ], "site_lbl": "Ser5" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The MyoD-inducible p204 protein overcomes the inhibition of myoblast differentiation by Id proteins.", "journal": "Mol. Cell. Biol.", "date": "2002", "authors": "Wang H., Liu C.-J., Ding B., Lengyel P.", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "reference": [ { "type": "PubMed", "id": "11940648", "url": "https://glygen.org/publication/PubMed/11940648" } ] }, { "title": "Nucleo-cytoplasmic shuttling of Id2, a negative regulator of basic helix-loop-helix transcription factors.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Yokota Y., Kurooka H.", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "reference": [ { "type": "PubMed", "id": "15563451", "url": "https://glygen.org/publication/PubMed/15563451" } ] }, { "title": "p204 protein overcomes the inhibition of the differentiation of P19 murine embryonal carcinoma cells to beating cardiac myocytes by Id proteins.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Ding B, Liu CJ, Huang Y, Yu J, Kong W, Lengyel P", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "reference": [ { "type": "PubMed", "id": "16556596", "url": "https://glygen.org/publication/PubMed/16556596" } ] }, { "title": "A role for Id2 in regulating photic entrainment of the mammalian circadian system.", "journal": "Curr. Biol.", "date": "2009", "authors": "Duffield GE, Watson NP, Mantani A, Peirson SN, Robles-Murguia M, Loros JJ, Israel MA, Dunlap JC", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "reference": [ { "type": "PubMed", "id": "19217292", "url": "https://glygen.org/publication/PubMed/19217292" } ] }, { "title": "Id proteins Id1 and Id2 selectively inhibit DNA binding by one class of helix-loop-helix proteins.", "journal": "Mol. Cell. Biol.", "date": "1991", "authors": "Copeland N.G., Jenkins N.A., Baltimore D., Sun X.H.", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "reference": [ { "type": "PubMed", "id": "1922066", "url": "https://glygen.org/publication/PubMed/1922066" } ] }, { "title": "Phospho-ablated Id2 is growth suppressive and pro-apoptotic in proliferating myoblasts.", "journal": "PloS one", "date": "2009", "authors": "Butler DC, Haramizu S, Williamson DL, Alway SE", "evidence": [ { "database": "iPTMnet", "id": "P41136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P41136" } ], "reference": [ { "type": "PubMed", "id": "19609365", "url": "https://glygen.org/publication/PubMed/19609365" } ] }, { "title": "ID2 (inhibitor of DNA binding 2) is a rhythmically expressed transcriptional repressor required for circadian clock output in mouse liver.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Duffield G.E., Hou T.Y., Ward S.M., Israel M.A., Murad J.M., Watson N.P.", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "reference": [ { "type": "PubMed", "id": "19740747", "url": "https://glygen.org/publication/PubMed/19740747" } ] }, { "title": "The transcriptional repressor ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Duffield G.E., Fernando S.J., Hou T.Y., Ward S.M.", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "reference": [ { "type": "PubMed", "id": "20861012", "url": "https://glygen.org/publication/PubMed/20861012" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" }, { "database": "iPTMnet", "id": "P41136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P41136" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Survival and differentiation of mammary epithelial cells in mammary gland development require nuclear retention of Id2 due to RANK signaling.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Kim NS, Kim HT, Kwon MC, Choi SW, Kim YY, Yoon KJ, Koo BK, Kong MP, Shin J, Cho Y, Kong YY", "evidence": [ { "database": "iPTMnet", "id": "P41136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P41136" } ], "reference": [ { "type": "PubMed", "id": "21947283", "url": "https://glygen.org/publication/PubMed/21947283" } ] }, { "title": "Insulin Elevates ID2 Expression in Trophoblasts and Aggravates Preeclampsia in Obese ASB4-Null Mice.", "journal": "International journal of molecular sciences", "date": "2023-01-21", "authors": "Kayashima Yukako, Townley-Tilson W H Davin, Vora Neeta L, Boggess Kim, Homeister Jonathon W, Maeda-Smithies Nobuyo, Li Feng", "evidence": [ { "database": "RefSeq", "id": "NP_034626", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034626" } ], "reference": [ { "type": "PubMed", "id": "36768469", "url": "https://glygen.org/publication/PubMed/36768469" } ] }, { "title": "The mouse Id2 and Id4 genes: structural organization and chromosomal localization.", "journal": "Gene", "date": "1998", "authors": "Kuo W.-L., Israel M.A., Hernandez M.-C., Mantani A.", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "reference": [ { "type": "PubMed", "id": "9831657", "url": "https://glygen.org/publication/PubMed/9831657" } ] } ], "pathway": [ { "id": "mmu:15902", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15902", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P41137-1", "protein_name": "DNA-binding protein inhibitor ID-2", "gene_name": "Id2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQTSRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG", "length": 134 }, "evidence": [ { "id": "45225554", "url": "http://www.informatics.jax.org/homology/45225554", "database": "MGI" }, { "id": "P41136", "url": "https://omabrowser.org/oma/group/P41136/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q02363-1", "protein_name": "DNA-binding protein inhibitor ID-2", "gene_name": "ID2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG", "length": 134 }, "evidence": [ { "id": "45225554", "url": "http://www.informatics.jax.org/homology/45225554", "database": "MGI" }, { "id": "P41136", "url": "https://omabrowser.org/oma/group/P41136/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 64, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "negative regulation of DNA-binding transcription factor activity", "id": "GO:0043433", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043433", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "regulation of G1/S transition of mitotic cell cycle", "id": "GO:2000045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000045", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "natural killer cell differentiation", "id": "GO:0001779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001779", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "enucleate erythrocyte differentiation", "id": "GO:0043353", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043353", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "astrocyte differentiation", "id": "GO:0048708", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048708", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "bundle of His development", "id": "GO:0003166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003166", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "endodermal digestive tract morphogenesis", "id": "GO:0061031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061031", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "heart development", "id": "GO:0007507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007507", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "adult locomotory behavior", "id": "GO:0008344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008344", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "positive regulation of fat cell differentiation", "id": "GO:0045600", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045600", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "positive regulation of blood pressure", "id": "GO:0045777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045777", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "white fat cell differentiation", "id": "GO:0050872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050872", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "adipose tissue development", "id": "GO:0060612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060612", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "regulation of lipid metabolic process", "id": "GO:0019216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019216", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "erythrocyte differentiation", "id": "GO:0030218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030218", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "regulation of neuron differentiation", "id": "GO:0045664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045664", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "Peyer's patch development", "id": "GO:0048541", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048541", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell proliferation", "id": "GO:0048661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048661", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "B cell differentiation", "id": "GO:0030183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030183", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "regulation of circadian rhythm", "id": "GO:0042752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042752", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "positive regulation of erythrocyte differentiation", "id": "GO:0045648", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045648", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "positive regulation of cell cycle", "id": "GO:0045787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045787", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "mammary gland alveolus development", "id": "GO:0060749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060749", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "locomotor rhythm", "id": "GO:0045475", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045475", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "circadian regulation of gene expression", "id": "GO:0032922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032922", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "metanephros development", "id": "GO:0001656", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001656", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "negative regulation of osteoblast differentiation", "id": "GO:0045668", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045668", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "cellular senescence", "id": "GO:0090398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090398", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "cell maturation", "id": "GO:0048469", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048469", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "entrainment of circadian clock", "id": "GO:0009649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009649", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "oligodendrocyte development", "id": "GO:0014003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014003", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "cell development", "id": "GO:0048468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048468", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "neuron fate commitment", "id": "GO:0048663", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048663", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "positive regulation of macrophage differentiation", "id": "GO:0045651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045651", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "negative regulation of muscle cell differentiation", "id": "GO:0051148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051148", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "negative regulation of core promoter binding", "id": "GO:1904797", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904797", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "cell morphogenesis involved in neuron differentiation", "id": "GO:0048667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048667", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "leukocyte differentiation", "id": "GO:0002521", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002521", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "entrainment of circadian clock by photoperiod", "id": "GO:0043153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043153", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "oligodendrocyte differentiation", "id": "GO:0048709", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048709", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "membranous septum morphogenesis", "id": "GO:0003149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003149", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "positive regulation of astrocyte differentiation", "id": "GO:0048711", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048711", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "cellular response to lithium ion", "id": "GO:0071285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071285", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "mammary gland epithelial cell proliferation", "id": "GO:0033598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033598", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "dopaminergic neuron differentiation", "id": "GO:0071542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071542", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "olfactory bulb development", "id": "GO:0021772", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021772", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "lymph node development", "id": "GO:0048535", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048535", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "negative regulation of oligodendrocyte differentiation", "id": "GO:0048715", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048715", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "negative regulation of DNA binding", "id": "GO:0043392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043392", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "embryonic digestive tract morphogenesis", "id": "GO:0048557", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048557", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "epithelial cell differentiation involved in mammary gland alveolus development", "id": "GO:0061030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061030", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "regulation of neural precursor cell proliferation", "id": "GO:2000177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000177", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "negative regulation of dopaminergic neuron differentiation", "id": "GO:1904339", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904339", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "negative regulation of B cell differentiation", "id": "GO:0045578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045578", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "thigmotaxis", "id": "GO:0001966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001966", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "euchromatin", "id": "GO:0000791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000791", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "transmembrane transporter binding", "id": "GO:0044325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044325", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" }, { "name": "transcription regulator inhibitor activity", "id": "GO:0140416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140416", "evidence": [ { "database": "UniProtKB", "id": "P41136", "url": "https://www.uniprot.org/uniprot/P41136" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 127, "end_pos": 129, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }