{ "uniprot_canonical_ac": "P40577-1", "uniprot_ac": "P40577", "uniprot_id": "MND2_YEAST", "mass": { "chemical_mass": 42826.0, "monoisotopic_mass": 42826.0 }, "refseq": { "ac": "NP_012291", "name": "Mnd2p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012291" }, "gene_names": [ { "name": "MND2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P40577", "id": "P40577" }, { "name": "MND2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012291", "id": "NP_012291" } ], "protein_names": [ { "name": "Anaphase-promoting complex subunit MND2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P40577" }, { "name": "Meiotic nuclear division protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P40577" }, { "name": "Mnd2p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012291", "id": "NP_012291" } ], "function": [ { "annotation": "Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome. In early mitosis, the APC/C is activated by CDC20 and targets securin PDS1, the B-type cyclin CLB5, and other anaphase inhibitory proteins for proteolysis, thereby triggering the separation of sister chromatids at the metaphase-to-anaphase transition. In late mitosis and in G1, degradation of CLB5 allows activation of the APC/C by CDH1, which is needed to destroy CDC20 and the B-type cyclin CLB2 to allow exit from mitosis and creating the low CDK state necessary for cytokinesis and for reforming prereplicative complexes in G1 prior to another round of replication.", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "common_name": "Yeast" } ], "gene": [ { "name": "MND2", "url": "https://www.uniprot.org/uniprot/P40577", "locus": {} } ], "crossref": [ { "id": "854843", "url": "https://www.ncbi.nlm.nih.gov/gene/854843", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P40577", "url": "https://www.ebi.ac.uk/intact/interactors/id:P40577*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR008402", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008402", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016807", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016807", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YIR025W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YIR025W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HERYNMR", "url": "https://omabrowser.org/oma/group/HERYNMR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2027551at2759", "url": "http://www.orthodb.org/?query=2027551at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "8A3T", "url": "https://www.rcsb.org/structure/8A3T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8A5Y", "url": "https://www.rcsb.org/structure/8A5Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8A61", "url": "https://www.rcsb.org/structure/8A61", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF05841", "url": "http://pfam.xfam.org/family/PF05841", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P40577", "url": "http://purl.obolibrary.org/obo/PR_P40577", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012291", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012291", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001464", "url": "https://www.yeastgenome.org/locus/S000001464", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P40577-1", "url": "https://www.uniprot.org/uniprot/P40577-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MARALRDISLFNDIRKDQNSAGAKHERYNMRDLRSKKNQHVNGIDDYEDDSLDRFIRRKKSRVVKYIPSLSAYNVFNEFPYYPTSASQLLDGKLDEFLMLSEQYKSRLPKIRKLGWNRFKPIGINKTMYELEMLRSRARAQNAEGNNEEDFRQHDSREEDPRNNGSIGRVILPHILQENEEYDTGEGVTGLHSMPNDSMAILANNSANNSQNEEVSEEDEISYDYDAEFDHVVDEDDNEEGEVPGEGVEGIEVQRERIVPDDLLMRPTSLSRSLQQFVEEAHHLDRNPYDIDSDNDGEDSKVELDMNPDFEDDVGREHDYNSEYSQEPTSYGGITPDLASNWRNWTRERITSLDELMERRARQQRGQD", "length": 368, "header": "sp|P40577-1|MND2_YEAST Isoform 1 of Anaphase-promoting complex subunit MND2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=MND2 PE=1 SV=1 CANONICAL=P40577-1" }, "isoforms": [ { "isoform_ac": "P40577-1", "url": "", "sequence": { "sequence": "MARALRDISLFNDIRKDQNSAGAKHERYNMRDLRSKKNQHVNGIDDYEDDSLDRFIRRKKSRVVKYIPSLSAYNVFNEFPYYPTSASQLLDGKLDEFLMLSEQYKSRLPKIRKLGWNRFKPIGINKTMYELEMLRSRARAQNAEGNNEEDFRQHDSREEDPRNNGSIGRVILPHILQENEEYDTGEGVTGLHSMPNDSMAILANNSANNSQNEEVSEEDEISYDYDAEFDHVVDEDDNEEGEVPGEGVEGIEVQRERIVPDDLLMRPTSLSRSLQQFVEEAHHLDRNPYDIDSDNDGEDSKVELDMNPDFEDDVGREHDYNSEYSQEPTSYGGITPDLASNWRNWTRERITSLDELMERRARQQRGQD", "length": 368, "header": "sp|P40577-1|MND2_YEAST Isoform 1 of Anaphase-promoting complex subunit MND2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=MND2 PE=1 SV=1 CANONICAL=P40577-1" }, "locus": { "chromosome": "IX", "start_pos": 404762, "end_pos": 403659, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YIR025W_mRNA", "url": "https://www.ensembl.org/id/YIR025W_mRNA" }, { "database": "Ensembl Peptide", "id": "YIR025W", "url": "https://www.ensembl.org/id/YIR025W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 268, "end_pos": 268, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P40577", "url": "https://www.yeastgenome.org/locus/P40577" }, { "database": "iPTMnet", "id": "P40577", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40577" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr268" }, { "start_pos": 293, "end_pos": 293, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P40577", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40577" } ], "site_lbl": "Ser293" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Proteomics analysis identifies new components of the fission and budding yeast anaphase-promoting complexes.", "journal": "Curr. Biol.", "date": "2002", "authors": "Gould K.L., Feoktistova A., Wolfe B.A., Jennings J.L., Link A.J., Yoon H.-J.", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "reference": [ { "type": "PubMed", "id": "12477395", "url": "https://glygen.org/publication/PubMed/12477395" } ] }, { "title": "Mnd2 and Swm1 are core subunits of the Saccharomyces cerevisiae anaphase-promoting complex.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Borchers C.H., Hall M.C., Torres M.P., Schroeder G.K.", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "reference": [ { "type": "PubMed", "id": "12609981", "url": "https://glygen.org/publication/PubMed/12609981" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" }, { "database": "iPTMnet", "id": "P40577", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40577" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P40577", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40577" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX.", "journal": "Nature", "date": "1997", "authors": "Connor R., Gentles S., Jones M., Pearson D., Smith V., Bowman S., Hunt S., Bankier A.T., Barrell B.G., Skelton J., Brown D., Rice P., Odell C., Whitehead S., Harris D.E., Badcock K., Chillingworth T., Churcher C.M., Devlin K., Hamlin N., Jagels K., Lye G., Moule S., Rajandream M.A., Rowley N., Walsh S.V., Horsnell T.", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "reference": [ { "type": "PubMed", "id": "9169870", "url": "https://glygen.org/publication/PubMed/9169870" } ] } ], "pathway": [ { "id": "sce:YIR025W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YIR025W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "deactivation of mitotic spindle assembly checkpoint", "id": "GO:1902426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902426", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "regulation of mitotic cell cycle", "id": "GO:0007346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007346", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "anaphase-promoting complex-dependent catabolic process", "id": "GO:0031145", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031145", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "regulation of mitotic metaphase/anaphase transition", "id": "GO:0030071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030071", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "regulation of meiotic cell cycle", "id": "GO:0051445", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051445", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "reciprocal meiotic recombination", "id": "GO:0007131", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007131", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "mitotic sister chromatid segregation", "id": "GO:0000070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000070", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "positive regulation of protein autoubiquitination", "id": "GO:1902499", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902499", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "negative regulation of anaphase-promoting complex-dependent catabolic process", "id": "GO:1905785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905785", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" }, { "name": "anaphase-promoting complex", "id": "GO:0005680", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005680", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "ubiquitin ligase inhibitor activity", "id": "GO:1990948", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990948", "evidence": [ { "database": "UniProtKB", "id": "P40577", "url": "https://www.uniprot.org/uniprot/P40577" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 125, "end_pos": 127, "annotation": "n_glycosylation_sequon" }, { "start_pos": 164, "end_pos": 166, "annotation": "n_glycosylation_sequon" }, { "start_pos": 196, "end_pos": 198, "annotation": "n_glycosylation_sequon" }, { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 208, "end_pos": 210, "annotation": "n_glycosylation_sequon" }, { "start_pos": 344, "end_pos": 346, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }