{
    "uniprot_canonical_ac": "P40561-1",
    "uniprot_ac": "P40561",
    "uniprot_id": "SGN1_YEAST",
    "mass": {
        "chemical_mass": 28954.0,
        "monoisotopic_mass": 28954.0
    },
    "refseq": {
        "ac": "NP_012266",
        "name": "Sgn1p",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012266"
    },
    "gene_names": [
        {
            "name": "SGN1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P40561",
            "id": "P40561"
        },
        {
            "name": "RBP1; RBP29",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012266",
            "id": "NP_012266"
        },
        {
            "name": "RBP29",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P40561",
            "id": "P40561"
        },
        {
            "name": "SGN1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012266",
            "id": "NP_012266"
        },
        {
            "name": "YIB1C",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P40561",
            "id": "P40561"
        }
    ],
    "protein_names": [
        {
            "name": "RNA-binding protein SGN1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P40561"
        },
        {
            "name": "Sgn1p",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012266",
            "id": "NP_012266"
        }
    ],
    "function": [
        {
            "annotation": "mRNA-binding protein that may play a role in modulating the expression of cytoplasmic mRNA.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P40561",
                    "url": "https://www.uniprot.org/uniprot/P40561#function"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:11719",
            "recommended_name": {
                "id": "DOID:11719",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:11719",
                "name": "oculopharyngeal muscular dystrophy",
                "description": ""
            },
            "synonyms": [
                {
                    "id": "DOID:11719",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:11719",
                    "name": "Muscular dystrophy, oculopharyngeal",
                    "description": ""
                },
                {
                    "id": "MONDO:0008116",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0008116",
                    "name": "oculopharyngeal muscular dystrophy",
                    "description": "Oculopharyngeal muscular dystrophy (OPMD) is an adult-onset progressive myopathy characterized by progressive eyelid ptosis, dysphagia, dysarthria and proximal limb weakness."
                },
                {
                    "id": "MONDO:0008116",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0008116",
                    "name": "OPMD",
                    "description": ""
                },
                {
                    "id": "MONDO:0008116",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0008116",
                    "name": "muscular dystrophy, oculopharyngeal",
                    "description": ""
                },
                {
                    "id": "MONDO:0008116",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0008116",
                    "name": "oculopharyngeal muscular dystrophy",
                    "description": ""
                },
                {
                    "id": "MIM:164300",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/164300",
                    "name": "Oculopharyngeal muscular dystrophy",
                    "description": "Oculopharyngeal muscular dystrophy"
                }
            ],
            "evidence": [
                {
                    "id": "11719",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:11719"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P40561",
                    "url": "https://www.uniprot.org/uniprot/P40561"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "SGN1",
            "url": "https://www.uniprot.org/uniprot/P40561",
            "locus": {
                "chromosome": "IX",
                "start_pos": 356143,
                "end_pos": 356895,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "YIR001C",
                        "url": "https://www.ensembl.org/id/YIR001C"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "cd12306",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12306",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "854817",
            "url": "https://www.ncbi.nlm.nih.gov/gene/854817",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "P40561",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P40561*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR000504",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR012677",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR035979",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YIR001C",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YIR001C",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "NNKNRTF",
            "url": "https://omabrowser.org/oma/group/NNKNRTF/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "155884at2759",
            "url": "http://www.orthodb.org/?query=155884at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23236",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23236",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23236:SF12",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23236:SF12",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00076",
            "url": "http://pfam.xfam.org/family/PF00076",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P40561",
            "url": "http://purl.obolibrary.org/obo/PR_P40561",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_012266",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012266",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000001440",
            "url": "https://www.yeastgenome.org/locus/S000001440",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P40561",
            "url": "https://www.uniprot.org/uniprot/P40561",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P40561-1",
            "url": "https://www.uniprot.org/uniprot/P40561-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSQEEKVDAKATLKTEISNNKKNDKQELELDELVGKLSIEGTPQVSQKLSKEEKHAHQLEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKALQLNGGELKGKKIAVSRKRTNIPGFNRHYNSQNQYFQQWQWNYPLMAYPNPDTFPYYPPYPPNQSPNQNFGYNKNNYYRSPYNNKNRTFQKKHFNSAKDSTKNIRSTSQKPVVMPSDNVKSSTQEKDSK",
        "length": 250,
        "header": "sp|P40561-1|SGN1_YEAST Isoform 1 of RNA-binding protein SGN1  OS=Saccharomyces cerevisiae S288C OX=559292 GN=SGN1 PE=1 SV=1 CANONICAL=P40561-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P40561-1",
            "url": "",
            "sequence": {
                "sequence": "MSQEEKVDAKATLKTEISNNKKNDKQELELDELVGKLSIEGTPQVSQKLSKEEKHAHQLEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKALQLNGGELKGKKIAVSRKRTNIPGFNRHYNSQNQYFQQWQWNYPLMAYPNPDTFPYYPPYPPNQSPNQNFGYNKNNYYRSPYNNKNRTFQKKHFNSAKDSTKNIRSTSQKPVVMPSDNVKSSTQEKDSK",
                "length": 250,
                "header": "sp|P40561-1|SGN1_YEAST Isoform 1 of RNA-binding protein SGN1  OS=Saccharomyces cerevisiae S288C OX=559292 GN=SGN1 PE=1 SV=1 CANONICAL=P40561-1"
            },
            "locus": {
                "chromosome": "IX",
                "start_pos": 356895,
                "end_pos": 356146,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YIR001C_mRNA",
                        "url": "https://www.ensembl.org/id/YIR001C_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YIR001C",
                        "url": "https://www.ensembl.org/id/YIR001C"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 199,
            "end_pos": 199,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P40561",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40561"
                },
                {
                    "database": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                },
                {
                    "database": "SGD",
                    "id": "P40561",
                    "url": "https://www.yeastgenome.org/locus/P40561"
                }
            ],
            "site_lbl": "Tyr199"
        },
        {
            "start_pos": 227,
            "end_pos": 227,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P40561",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40561"
                },
                {
                    "database": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                },
                {
                    "database": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                },
                {
                    "database": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                }
            ],
            "site_lbl": "Ser227"
        },
        {
            "start_pos": 229,
            "end_pos": 229,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P40561",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40561"
                },
                {
                    "database": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                },
                {
                    "database": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                },
                {
                    "database": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                },
                {
                    "database": "SGD",
                    "id": "P40561",
                    "url": "https://www.yeastgenome.org/locus/P40561"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Ser229"
        },
        {
            "start_pos": 38,
            "end_pos": 38,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P40561",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40561"
                },
                {
                    "database": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ],
            "site_lbl": "Ser38"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The Saccharomyces cerevisiae RNA-binding protein Rbp29 functions in cytoplasmic mRNA metabolism.",
            "journal": "J. Biol. Chem.",
            "date": "2000",
            "authors": "Wahle E., Kuhn U., Winstall E., Sadowski M., Sachs A.B.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P40561",
                    "url": "https://www.uniprot.org/uniprot/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10764794",
                    "url": "https://glygen.org/publication/PubMed/10764794"
                }
            ]
        },
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P40561",
                    "url": "https://www.uniprot.org/uniprot/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.",
            "journal": "Science (New York, N.Y.)",
            "date": "2009-09-25",
            "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P40561",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                }
            ]
        },
        {
            "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.",
            "journal": "Proteomics",
            "date": "2009-10",
            "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P40561",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                }
            ]
        },
        {
            "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.",
            "journal": "Molecular bioSystems",
            "date": "2009-11",
            "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P40561",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                }
            ]
        },
        {
            "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.",
            "journal": "BMC genomics",
            "date": "2010-12-02",
            "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P40561",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ]
        },
        {
            "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.",
            "journal": "Science signaling",
            "date": "2010-12-21",
            "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P40561",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                }
            ]
        },
        {
            "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.",
            "journal": "Nature methods",
            "date": "2013-07",
            "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P40561",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P40561",
                    "url": "https://www.uniprot.org/uniprot/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "Nucleotide sequence and analysis of the centromeric region of yeast chromosome IX.",
            "journal": "Yeast",
            "date": "1995",
            "authors": "Ansorge W., Wiemann S., Zimmermann J., Sander C., Valencia A., Schwager C., Voss H., Sensen C., Tamames J., Teodoru C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P40561",
                    "url": "https://www.uniprot.org/uniprot/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7762303",
                    "url": "https://glygen.org/publication/PubMed/7762303"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Connor R., Gentles S., Jones M., Pearson D., Smith V., Bowman S., Hunt S., Bankier A.T., Barrell B.G., Skelton J., Brown D., Rice P., Odell C., Whitehead S., Harris D.E., Badcock K., Chillingworth T., Churcher C.M., Devlin K., Hamlin N., Jagels K., Lye G., Moule S., Rajandream M.A., Rowley N., Walsh S.V., Horsnell T.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P40561",
                    "url": "https://www.uniprot.org/uniprot/P40561"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169870",
                    "url": "https://glygen.org/publication/PubMed/9169870"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YIR001C",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YIR001C",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 1,
                "go_terms": [
                    {
                        "name": "mRNA metabolic process",
                        "id": "GO:0016071",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016071",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P40561",
                                "url": "https://www.uniprot.org/uniprot/P40561"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P40561",
                                "url": "https://www.uniprot.org/uniprot/P40561"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "poly(A) binding",
                        "id": "GO:0008143",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008143",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P40561",
                                "url": "https://www.uniprot.org/uniprot/P40561"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 184,
            "end_pos": 186,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 207,
            "end_pos": 209,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 70,
            "end_pos": 72,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                },
                {
                    "field": "total_sites",
                    "count": 4
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 11
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}