{ "uniprot_canonical_ac": "P40449-1", "uniprot_ac": "P40449", "uniprot_id": "YIQ1_YEAST", "mass": { "chemical_mass": 27112.0, "monoisotopic_mass": 27112.0 }, "refseq": { "ac": "NP_012105", "name": "Smu2p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012105" }, "gene_names": [ { "name": "SMU2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012105", "id": "NP_012105" } ], "protein_names": [ { "name": "Uncharacterized protein YIL161W", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P40449" }, { "name": "Smu2p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012105", "id": "NP_012105" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P40449", "url": "https://www.uniprot.org/uniprot/P40449" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/P40449", "locus": {} } ], "crossref": [ { "id": "854645", "url": "https://www.ncbi.nlm.nih.gov/gene/854645", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P40449", "url": "https://www.ebi.ac.uk/intact/interactors/id:P40449*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "sce:YIL161W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YIL161W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VKEDWRI", "url": "https://omabrowser.org/oma/group/VKEDWRI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2029585at2759", "url": "http://www.orthodb.org/?query=2029585at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "7ZW0", "url": "https://www.rcsb.org/structure/7ZW0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PR_P40449", "url": "http://purl.obolibrary.org/obo/PR_P40449", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012105", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012105", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001423", "url": "https://www.yeastgenome.org/locus/S000001423", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P40449", "url": "https://www.uniprot.org/uniprot/P40449", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P40449-1", "url": "https://www.uniprot.org/uniprot/P40449-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDTKLSVTGAKKSQGKASGLGNEGTPIGNEESTNKAKNGNKKRNKNRNRNKKTETKEQNEPKPVTGGEEVRVEKSQAKNRRRKNNNGANKKNTLHYSKEINVEERKQIAKRQEEIEQCIHTLSDFKLFKKGKHVTSYGYRISPMTDSGKISLKILFNIPLDYPKAPIKLTMKSNEEVSSYMDTVIANFNWKARQLVKEDWRILSQINYLVSELEILKMENYKQIDKLRNSFYKTI", "length": 235, "header": "sp|P40449-1|YIQ1_YEAST Isoform 1 of Uncharacterized protein YIL161W OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=P40449-1" }, "isoforms": [ { "isoform_ac": "P40449-1", "url": "", "sequence": { "sequence": "MDTKLSVTGAKKSQGKASGLGNEGTPIGNEESTNKAKNGNKKRNKNRNRNKKTETKEQNEPKPVTGGEEVRVEKSQAKNRRRKNNNGANKKNTLHYSKEINVEERKQIAKRQEEIEQCIHTLSDFKLFKKGKHVTSYGYRISPMTDSGKISLKILFNIPLDYPKAPIKLTMKSNEEVSSYMDTVIANFNWKARQLVKEDWRILSQINYLVSELEILKMENYKQIDKLRNSFYKTI", "length": 235, "header": "sp|P40449-1|YIQ1_YEAST Isoform 1 of Uncharacterized protein YIL161W OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=P40449-1" }, "locus": { "chromosome": "IX", "start_pos": 40137, "end_pos": 39433, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YIL161W_mRNA", "url": "https://www.ensembl.org/id/YIL161W_mRNA" }, { "database": "Ensembl Peptide", "id": "YIL161W", "url": "https://www.ensembl.org/id/YIL161W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 204, "end_pos": 204, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40449", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40449" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P40449", "url": "https://www.yeastgenome.org/locus/P40449" } ], "site_lbl": "Ser204" }, { "start_pos": 208, "end_pos": 208, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40449", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40449" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P40449", "url": "https://www.yeastgenome.org/locus/P40449" } ], "site_lbl": "Tyr208" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40449", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40449" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P40449", "url": "https://www.yeastgenome.org/locus/P40449" } ], "site_lbl": "Ser211" }, { "start_pos": 221, "end_pos": 221, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40449", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40449" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Tyr221" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P40449", "url": "https://www.uniprot.org/uniprot/P40449" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "iPTMnet", "id": "P40449", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40449" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P40449", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40449" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Sites of ubiquitin attachment in Saccharomyces cerevisiae.", "journal": "Proteomics", "date": "2012", "authors": "Eng J.K., Fields S., Lo R.S., Starita L.M., von Haller P.D.", "evidence": [ { "database": "UniProtKB", "id": "P40449", "url": "https://www.uniprot.org/uniprot/P40449" } ], "reference": [ { "type": "PubMed", "id": "22106047", "url": "https://glygen.org/publication/PubMed/22106047" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P40449", "url": "https://www.uniprot.org/uniprot/P40449" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX.", "journal": "Nature", "date": "1997", "authors": "Connor R., Gentles S., Jones M., Pearson D., Smith V., Bowman S., Hunt S., Bankier A.T., Barrell B.G., Skelton J., Brown D., Rice P., Odell C., Whitehead S., Harris D.E., Badcock K., Chillingworth T., Churcher C.M., Devlin K., Hamlin N., Jagels K., Lye G., Moule S., Rajandream M.A., Rowley N., Walsh S.V., Horsnell T.", "evidence": [ { "database": "UniProtKB", "id": "P40449", "url": "https://www.uniprot.org/uniprot/P40449" } ], "reference": [ { "type": "PubMed", "id": "9169870", "url": "https://glygen.org/publication/PubMed/9169870" } ] } ], "pathway": [ { "id": "sce:YIL161W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YIL161W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }