{ "uniprot_canonical_ac": "P40350-1", "uniprot_ac": "P40350", "uniprot_id": "ALG5_YEAST", "mass": { "chemical_mass": 38347.0, "monoisotopic_mass": 38347.0 }, "refseq": { "ac": "NP_015097", "name": "dolichyl-phosphate beta-glucosyltransferase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015097" }, "gene_names": [ { "name": "ALG5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P40350", "id": "P40350" }, { "name": "ALG5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015097", "id": "NP_015097" }, { "name": "P1437", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P40350", "id": "P40350" } ], "protein_names": [ { "name": "Dolichyl-phosphate beta-glucosyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P40350" }, { "name": "2.4.1.117", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P40350" }, { "name": "Asparagine-linked glycosylation protein 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P40350" }, { "name": "DolP-glucosyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P40350" }, { "name": "dolichyl-phosphate beta-glucosyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015097", "id": "NP_015097" } ], "function": [ { "annotation": "Endoplasmic reticulum membrane-bound UDP-glucose:dolichyl-phosphate glucosyltransferase involved in protein N-linked glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "P40350", "url": "https://www.uniprot.org/uniprot/P40350#function" }, { "database": "PubMed", "id": "8076653", "url": "https://glygen.org/publication/PubMed/8076653" } ] } ], "disease": [ { "disease_id": "DOID:0050570", "recommended_name": { "id": "DOID:0050570", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050570", "name": "congenital disorder of glycosylation type I", "description": "A congenital disorder of glycosylation characterized by under-glycosylated serum glycoproteins." }, "synonyms": [ { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "PMM2-congenital disorder of glycosylation", "description": "The most frequent form of congenital disorder of N-glycosylation and is characterized by cerebellar dysfunction, abnormal fat distribution, inverted nipples, strabismus and hypotonia. 3 forms of PMM2-CDG can be distinguished: the infantile multisystem type, late-infantile and childhood ataxia-intellectual disability type (3-10 yrs old), and the adult stable disability type. Infants usually develop ataxia, psychomotor delay and extraneurological manifestations including failure to thrive, enteropathy, hepatic dysfunction, coagulation abnormalities and cardiac and renal involvement. The phenotype is however highly variable and ranges from infants who die in the first year of life to mildly involved adults." }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "CDG 1A", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "CDG syndrome type Ia", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "CDG-IA", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "CDG1A", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "PMM2-CDG", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "PMM2-congenital disorder of glycosylation", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "carbohydrate deficient glycoprotein syndrome type Ia", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "congenital disorder of glycosylation type 1a", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "congenital disorder of glycosylation type Ia", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "phosphomannomutase 2 deficiency", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "Jaeken syndrome", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "PMM2-CDG (CDG-Ia)", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "carbohydrate-deficient glycoprotein syndrome type 1A", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "carbohydrate-deficient glycoprotein syndrome type 1A (formerly)", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "carbohydrate-deficient glycoprotein syndrome, type Ia", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "carbohydrate-deficient glycoprotein syndrome, type Ia, formerly", "description": "" }, { "id": "MONDO:0008907", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008907", "name": "congenital disorder of glycosylation, type Ia", "description": "" }, { "id": "MIM:212065", "resource": "MIM", "url": "https://www.omim.org/entry/212065", "name": "Congenital disorder of glycosylation 1A", "description": "Congenital disorder of glycosylation 1A" } ], "evidence": [ { "id": "0050570", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050570" } ] }, { "disease_id": "DOID:0080322", "recommended_name": { "id": "DOID:0080322", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080322", "name": "polycystic kidney disease", "description": "A cystic kidney disease that is characterized by the growth of fluid-filled cysts in the kidneys that reduces kidney function and may lead to kidney failure." }, "synonyms": [ { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease 1", "description": "Any autosomal dominant polycystic kidney disease in which the cause of the disease is a mutation in the PKD1 gene." }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "APKD1", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "PKD1", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "PKD1 autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "autosomal dominant polycystic kidney disease caused by mutation in PKD1", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease 1", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease type 1", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease, adult, type I", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "Potter type 3 polycystic kidney disease", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "Potter type 3 polycystic kidney disease, formerly", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease 1 with or without polycystic liver disease", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease, adult", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease, adult, type 1", "description": "" }, { "id": "MIM:173900", "resource": "MIM", "url": "https://www.omim.org/entry/173900", "name": "Polycystic kidney disease 1 with or without polycystic liver disease", "description": "Polycystic kidney disease 1 with or without polycystic liver disease" } ], "evidence": [ { "id": "0080322", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080322" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P40350", "url": "https://www.uniprot.org/uniprot/P40350" } ], "common_name": "Yeast" } ], "gene": [ { "name": "ALG5", "url": "https://www.uniprot.org/uniprot/P40350", "locus": {} } ], "crossref": [ { "id": "GT2", "url": "http://www.cazy.org/GT2.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "cd04188", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04188", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "855874", "url": "https://www.ncbi.nlm.nih.gov/gene/855874", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P40350", "url": "https://www.ebi.ac.uk/intact/interactors/id:P40350*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001173", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001173", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029044", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029044", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035518", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035518", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YPL227C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPL227C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HMVNTDA", "url": "https://omabrowser.org/oma/group/HMVNTDA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "179325at2759", "url": "http://www.orthodb.org/?query=179325at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10859", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10859", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10859:SF91", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10859:SF91", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00535", "url": "http://pfam.xfam.org/family/PF00535", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P40350", "url": "http://purl.obolibrary.org/obo/PR_P40350", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_015097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015097", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000006148", "url": "https://www.yeastgenome.org/locus/S000006148", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P40350", "url": "https://www.uniprot.org/uniprot/P40350", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P40350-1", "url": "https://www.uniprot.org/uniprot/P40350-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAIDEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLKEKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTTKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCGFKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDGSKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC", "length": 334, "header": "sp|P40350-1|ALG5_YEAST Isoform 1 of Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae S288C OX=559292 GN=ALG5 PE=1 SV=1 CANONICAL=P40350-1" }, "isoforms": [ { "isoform_ac": "P40350-1", "url": "", "sequence": { "sequence": "MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAIDEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLKEKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTTKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCGFKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDGSKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC", "length": 334, "header": "sp|P40350-1|ALG5_YEAST Isoform 1 of Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae S288C OX=559292 GN=ALG5 PE=1 SV=1 CANONICAL=P40350-1" }, "locus": { "chromosome": "XVI", "start_pos": 121167, "end_pos": 120166, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YPL227C_mRNA", "url": "https://www.ensembl.org/id/YPL227C_mRNA" }, { "database": "Ensembl Peptide", "id": "YPL227C", "url": "https://www.ensembl.org/id/YPL227C" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 119, "start_aa": "Asn", "end_pos": 119, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn119", "evidence": [ { "id": "P40350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40350#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 83, "start_aa": "Asn", "end_pos": 83, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn83", "evidence": [ { "id": "P40350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40350#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P40350", "url": "https://www.uniprot.org/uniprot/P40350" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P40350", "url": "https://www.uniprot.org/uniprot/P40350" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Isolation of the ALG5 locus encoding the UDP-glucose:dolichyl-phosphate glucosyltransferase from Saccharomyces cerevisiae.", "journal": "Eur. J. Biochem.", "date": "1994", "authors": "Aebi M., Lehle L., Te Heesen S., Weissmann A.", "evidence": [ { "database": "UniProtKB", "id": "P40350", "url": "https://www.uniprot.org/uniprot/P40350" } ], "reference": [ { "type": "PubMed", "id": "8076653", "url": "https://glygen.org/publication/PubMed/8076653" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Davis K., Duesterhoeft A., Hillier L.W., Mewes H.-W., Pearson D., Schaefer M., Scharfe M., Wambutt R., Wang Y., Wedler H., Hall J., Bowman S., Chung E., Benes V., Botstein D., Brueckner M., Davis R.W., Lin A., Lin D., Duncan M., Barrell B.G., Rieger M., Ahmed A., Schroeder M., Oefner P., Delius H., Kleine K., Floeth M., Bussey H., Voss H., Lashkari D., Allen E., Dubois E., Hyman R.W., Aparicio A., Araujo R., Kalman S., Komp C., Kurdi O., Lew H., Namath A., Roberts D., Friesen J.D., Louis E.J., Johnston M., Pohl T.M., Schramm S., Cherry J.M., Badcock K., Churcher C.M., DiPaolo T., Dietrich F.S., Goffeau A., Hani J., Messenguy F., Mueller-Auer S., Rajandream M.A., Scherens B., Vissers S., Walsh S.V., Zollner A., Fortin N., Purnelle B., Sdicu A.-M., Storms R.K., Urrestarazu L.A., Vierendeels F., Vo D.H., Zhong W.-W., Albermann K., Carpenter J., Coster F., Fritz C., Hebling U., Heumann K., Hilbert H., Hunicke-Smith S., Marathe R., Mirtipati S., Moestl D., Nentwich U., Petel F.X., Rechmann S., Riles L., Tettelin H., Ushinsky S., Wedler E., Winnett E.", "evidence": [ { "database": "UniProtKB", "id": "P40350", "url": "https://www.uniprot.org/uniprot/P40350" } ], "reference": [ { "type": "PubMed", "id": "9169875", "url": "https://glygen.org/publication/PubMed/9169875" } ] } ], "pathway": [ { "id": "sce:YPL227C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPL227C", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9DB25-1", "protein_name": "Dolichyl-phosphate beta-glucosyltransferase", "gene_name": "Alg5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MATLLLQLLGLGVALAAAALILVSIVAFITATKMPPCYQHEEEKFFLNAKGQKEALPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALNYLEKRQKHDCTFTYEVIVVDDGSEDQTSKVALKYCQKYGSDKVRVITLVRNRGKGGAVRMGVFSSRGEKILMADADGATKFPDVEKLEKGLSDLQPWPEQMAIACGSRAHLEKESIAQRSYFRTFLMYGFHFLVWFLCVKGIRDTQCGFKLLTREAAARTFSSLHIERWAFDVELLYIAQCLQIPIAEVAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLKQTRKAS", "length": 324 }, "evidence": [ { "id": "P40350", "url": "https://omabrowser.org/oma/group/P40350/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VLQ1-1", "protein_name": "Dolichyl-phosphate beta-glucosyltransferase", "gene_name": "wol", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MWTCLCQLCFYLLSTLAVAALSIAALVLYKTKPYPNIKRHKDEETFLDPHTIKTVTFPSLEDSPSLELSVIVPAYNEEQRLPSMLDECLAFLEQKSAGTPNFTYEVIVVSDGSQDATVSVALGYSKKHGAEKVRVLELIENRGKGGAVRMGMLSARGRNLLFADADGATKFPDYDKLEVALKQLAPEWRDDGIAIGSRAHLENDAIATRSFFRTILMHGFHFLVWLFAVRSIRDTQCGFKLFTRTTARKLFTSLHVERWAFDVELLYLAENLKLPMSEVAVRWTEIDGSKLTPFWSWLQMGRDLFMIWVRYLVGAWRIASIQKKEK", "length": 326 }, "evidence": [ { "id": "P40350", "url": "https://omabrowser.org/oma/group/P40350/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9Y673-1", "protein_name": "Dolichyl-phosphate beta-glucosyltransferase", "gene_name": "ALG5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN", "length": 324 }, "evidence": [ { "id": "P40350", "url": "https://omabrowser.org/oma/group/P40350/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P40350", "url": "https://www.uniprot.org/uniprot/P40350" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "dolichyl-phosphate beta-glucosyltransferase activity", "id": "GO:0004581", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004581", "evidence": [ { "database": "UniProtKB", "id": "P40350", "url": "https://www.uniprot.org/uniprot/P40350" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "protein N-linked glycosylation", "id": "GO:0006487", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006487", "evidence": [ { "database": "UniProtKB", "id": "P40350", "url": "https://www.uniprot.org/uniprot/P40350" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 119, "end_pos": 121, "annotation": "n_glycosylation_sequon" }, { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "15401", "name": "", "equation": "a dolichyl phosphate + UDP-alpha-D-glucose = a dolichyl beta-D-glucosyl phosphate + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A6JVD5-1", "Q9Y673-1", "Q9DB25-1", "P40350-1", "Q54J42-1", "Q9VLQ1-1" ], "evidence": [ { "id": "15401", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/15401" } ] }, { "id": "R-SCE-446214", "name": "Synthesis of dolichyl-phosphate-glucose", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-532214", "R-ALL-110096" ], "enzyme_list": [ "P40350-1" ], "evidence": [ { "id": "R-SCE-446214", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-446214" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-110096", "participant_name": "UDP [cytosol]", "crossref": [ { "id": "C00015", "database": "COMPOUND", "url": "" }, { "id": "58223", "database": "ChEBI", "url": "" }, { "id": "000004490939", "database": "ZINC", "url": "" }, { "id": "C00015", "database": "COMPOUND", "url": "" }, { "id": "58223", "database": "ChEBI", "url": "" }, { "id": "000004490939", "database": "ZINC", "url": "" }, { "id": "C00015", "database": "COMPOUND", "url": "" }, { "id": "58223", "database": "ChEBI", "url": "" }, { "id": "000004490939", "database": "ZINC", "url": "" }, { "id": "C00015", "database": "COMPOUND", "url": "" }, { "id": "58223", "database": "ChEBI", "url": "" }, { "id": "000004490939", "database": "ZINC", "url": "" }, { "id": "58223", "database": "ChEBI", "url": "" }, { "id": "C00015", "database": "COMPOUND", "url": "" }, { "id": "000004490939", "database": "ZINC", "url": "" }, { "id": "C00015", "database": "COMPOUND", "url": "" }, { "id": "58223", "database": "ChEBI", "url": "" }, { "id": "000004490939", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-532214", "participant_name": "DbGP [integral component of cytoplasmic side of endoplasmic reticulum membrane]", "crossref": [ { "id": "15812", "database": "ChEBI", "url": "" }, { "id": "HMDB0001054", "database": "HMDB Metabolite", "url": "" }, { "id": "000030724105", "database": "ZINC", "url": "" }, { "id": "000030724110", "database": "ZINC", "url": "" }, { "id": "C01246", "database": "COMPOUND", "url": "" }, { "id": "15812", "database": "ChEBI", "url": "" }, { "id": "HMDB0001054", "database": "HMDB Metabolite", "url": "" }, { "id": "000030724105", "database": "ZINC", "url": "" }, { "id": "000030724110", "database": "ZINC", "url": "" }, { "id": "C01246", "database": "COMPOUND", "url": "" }, { "id": "15812", "database": "ChEBI", "url": "" }, { "id": "HMDB0001054", "database": "HMDB Metabolite", "url": "" }, { "id": "000030724105", "database": "ZINC", "url": "" }, { "id": "000030724110", "database": "ZINC", "url": "" }, { "id": "C01246", "database": "COMPOUND", "url": "" }, { "id": "15812", "database": "ChEBI", "url": "" }, { "id": "HMDB0001054", "database": "HMDB Metabolite", "url": "" }, { "id": "000030724105", "database": "ZINC", "url": "" }, { "id": "000030724110", "database": "ZINC", "url": "" }, { "id": "C01246", "database": "COMPOUND", "url": "" }, { "id": "000030724105", "database": "ZINC", "url": "" }, { "id": "C01246", "database": "COMPOUND", "url": "" }, { "id": "15812", "database": "ChEBI", "url": "" }, { "id": "HMDB0001054", "database": "HMDB Metabolite", "url": "" }, { "id": "000030724110", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A6JVD5", "gene_name": "Alg5", "activity": [ { "ec_number": "2.4.1.117", "activity": "a dolichyl phosphate + UDP-alpha-D-glucose = a dolichyl beta-D-glucosyl phosphate + UDP.", "evidence": [ { "id": "A6JVD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6JVD5" } ] }, { "ec_number": "2.4.1.117", "activity": "", "evidence": [ { "id": "A6JVD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6JVD5" } ] } ] }, { "uniprot_ac": "P40350", "gene_name": "ALG5", "activity": [ { "ec_number": "2.4.1.117", "activity": "a dolichyl phosphate + UDP-alpha-D-glucose = a dolichyl beta-D-glucosyl phosphate + UDP.", "evidence": [ { "id": "P40350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40350" } ] }, { "ec_number": "2.4.1.117", "activity": "", "evidence": [ { "id": "P40350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40350" } ] } ] }, { "uniprot_ac": "Q54J42", "gene_name": "alg5", "activity": [ { "ec_number": "2.4.1.117", "activity": "a dolichyl phosphate + UDP-alpha-D-glucose = a dolichyl beta-D-glucosyl phosphate + UDP.", "evidence": [ { "id": "Q54J42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54J42" } ] }, { "ec_number": "2.4.1.117", "activity": "", "evidence": [ { "id": "Q54J42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54J42" } ] } ] }, { "uniprot_ac": "Q9DB25", "gene_name": "Alg5", "activity": [ { "ec_number": "2.4.1.117", "activity": "a dolichyl phosphate + UDP-alpha-D-glucose = a dolichyl beta-D-glucosyl phosphate + UDP.", "evidence": [ { "id": "Q9DB25", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DB25" } ] }, { "ec_number": "2.4.1.117", "activity": "", "evidence": [ { "id": "Q9DB25", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DB25" } ] } ] }, { "uniprot_ac": "Q9VLQ1", "gene_name": "wol", "activity": [ { "ec_number": "2.4.1.117", "activity": "a dolichyl phosphate + UDP-alpha-D-glucose = a dolichyl beta-D-glucosyl phosphate + UDP.", "evidence": [ { "id": "Q9VLQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VLQ1" } ] }, { "ec_number": "2.4.1.117", "activity": "", "evidence": [ { "id": "Q9VLQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VLQ1" } ] } ] }, { "uniprot_ac": "Q9Y673", "gene_name": "ALG5", "activity": [ { "ec_number": "2.4.1.117", "activity": "a dolichyl phosphate + UDP-alpha-D-glucose = a dolichyl beta-D-glucosyl phosphate + UDP.", "evidence": [ { "id": "Q9Y673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y673" } ] }, { "ec_number": "2.4.1.117", "activity": "", "evidence": [ { "id": "Q9Y673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y673" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }