{ "uniprot_canonical_ac": "P40093-1", "uniprot_ac": "P40093", "uniprot_id": "YEY6_YEAST", "mass": { "chemical_mass": 38174.0, "monoisotopic_mass": 38174.0 }, "refseq": { "ac": "NP_011083", "name": "Myg1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011083" }, "gene_names": [ { "name": "MYG1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011083", "id": "NP_011083" } ], "protein_names": [ { "name": "MYG1 protein YER156C", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P40093" }, { "name": "Myg1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011083", "id": "NP_011083" } ], "function": [], "disease": [ { "disease_id": "DOID:12306", "recommended_name": { "id": "DOID:12306", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12306", "name": "vitiligo", "description": "An autoimmune disease that causes depigmentation of patches of skin resulting from loss of function or death of melanoctyes." }, "synonyms": [ { "id": "MONDO:0700077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700077", "name": "vitiligo-associated multiple autoimmune disease susceptibility 6", "description": "" }, { "id": "MONDO:0700077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700077", "name": "VAMAS6", "description": "" }, { "id": "MIM:193200", "resource": "MIM", "url": "https://www.omim.org/entry/193200", "name": "Vitiligo", "description": "Vitiligo" } ], "evidence": [ { "id": "12306", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12306" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P40093", "url": "https://www.uniprot.org/uniprot/P40093" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/P40093", "locus": {} } ], "crossref": [ { "id": "856900", "url": "https://www.ncbi.nlm.nih.gov/gene/856900", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P40093", "url": "https://www.ebi.ac.uk/intact/interactors/id:P40093*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003226", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003226", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YER156C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YER156C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FHCDEVV", "url": "https://omabrowser.org/oma/group/FHCDEVV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "19907at2759", "url": "http://www.orthodb.org/?query=19907at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11215", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11215", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11215:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11215:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03690", "url": "http://pfam.xfam.org/family/PF03690", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P40093", "url": "http://purl.obolibrary.org/obo/PR_P40093", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_011083", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011083", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000000958", "url": "https://www.yeastgenome.org/locus/S000000958", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P40093", "url": "https://www.uniprot.org/uniprot/P40093", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P40093-1", "url": "https://www.uniprot.org/uniprot/P40093-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNSVKRVKLNSKMSKQICTHSGSFHADESLAVYMLRLLPEFKDAKLVRSRNPKDWEASDILVDVGAQYDGVKFFDHHQRGFFETFNEKYKTKLSSAGLIFKHYGRDIIKTILNNKVSSSDLDLLYDKVYKQFVEALDANDNGISKYTIPKDSNLEPNFRDNAISIPGIISGMNPNWNEDTSDESFDRCFARASEFIGGVFVTLVRGYGQSWLPAKALVAQAIDERMDVDKSGKIIVLPQFCPWKEHLYELEREKNIEKQIEFVLFTDSSGAWRVSTVPINSTSFQFRRGLPEPLRGLRDEELSTKSGVPGCIFIHAAGFIGGAKSKEAVYELAKMSLA", "length": 338, "header": "sp|P40093-1|YEY6_YEAST Isoform 1 of MYG1 protein YER156C OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=P40093-1" }, "isoforms": [ { "isoform_ac": "P40093-1", "url": "", "sequence": { "sequence": "MNSVKRVKLNSKMSKQICTHSGSFHADESLAVYMLRLLPEFKDAKLVRSRNPKDWEASDILVDVGAQYDGVKFFDHHQRGFFETFNEKYKTKLSSAGLIFKHYGRDIIKTILNNKVSSSDLDLLYDKVYKQFVEALDANDNGISKYTIPKDSNLEPNFRDNAISIPGIISGMNPNWNEDTSDESFDRCFARASEFIGGVFVTLVRGYGQSWLPAKALVAQAIDERMDVDKSGKIIVLPQFCPWKEHLYELEREKNIEKQIEFVLFTDSSGAWRVSTVPINSTSFQFRRGLPEPLRGLRDEELSTKSGVPGCIFIHAAGFIGGAKSKEAVYELAKMSLA", "length": 338, "header": "sp|P40093-1|YEY6_YEAST Isoform 1 of MYG1 protein YER156C OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=P40093-1" }, "locus": { "chromosome": "V", "start_pos": 484341, "end_pos": 483328, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YER156C_mRNA", "url": "https://www.ensembl.org/id/YER156C_mRNA" }, { "database": "Ensembl Peptide", "id": "YER156C", "url": "https://www.ensembl.org/id/YER156C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P40093", "url": "https://www.uniprot.org/uniprot/P40093" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P40093", "url": "https://www.uniprot.org/uniprot/P40093" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P40093", "url": "https://www.uniprot.org/uniprot/P40093" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome V.", "journal": "Nature", "date": "1997", "authors": "Smith V., Chen E., Guzman E., Chung E., Nakahara K., Botstein D., Davis R.W., Lin D., Wei Y., Duncan M., Berno A., Oh C., Oefner P., Taylor P., Lashkari D., Allen E., Hyman R.W., Araujo R., Komp C., Lew H., Namath A., Roberts D., Mulligan J.T., Sehl P., Schramm S., Hartzell G., Cherry J.M., Dietrich F.S., Aviles E., Brennan T., Carpenter J., Hennessy K.M., Hunicke-Smith S., Kayser A., Mosedale D., Norgren R., Petel F.X., Shogren T., Yelton M.A.", "evidence": [ { "database": "UniProtKB", "id": "P40093", "url": "https://www.uniprot.org/uniprot/P40093" } ], "reference": [ { "type": "PubMed", "id": "9169868", "url": "https://glygen.org/publication/PubMed/9169868" } ] } ], "pathway": [ { "id": "sce:YER156C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YER156C", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q641W2-1", "protein_name": "MYG1 exonuclease", "gene_name": "Myg1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGRGFLRGVLTLLPLRSVLQVQHCMLVSEPDLPPKRPRNNLMAPPRIGTHNGTFHCDEALACALLRLLPEYRNAEIVRTRDPEKLALCDIVVDVGGEYNPQRHRYDHHQRTFTETMSSLCPGKPWQTKLSSAGLVYLHFGHKLLAQLLGTSEEDSVVDTIYDKMYENFVEEVDAVDNGISQWAEGEPRYALTTTLSARVSRLNPTWNQPDQDTEAGFRRAMDLVQEEFLQRLNFYQHSWLPARALVEEALAQRFKVDSSGEIVELAKGGCPWKEHLYHLESELSPTVAITFVIYTDQAGQWRVQCVPKEPHSFQSRLPLPEPWRGLRDEALDQVSGIPGCIFVHASGFIGGHHTREGALNMARATLAQRTAPVPLANAVVQ", "length": 381 }, "evidence": [ { "id": "P40093", "url": "https://omabrowser.org/oma/group/P40093/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9JK81-1", "protein_name": "MYG1 exonuclease", "gene_name": "Myg1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGRRFLRGILTLPLRSVLQAQHRMLGSEQDPPAKRPRNNLMAPPRIGTHNGTFHCDEALACALLRLLPEYANAEIVRTRDPEKLASCDIVVDVGGEYNPQSHRYDHHQRTFTETMSSLCPGKPWQTKLSSAGLVYLHFGRKLLAQLLGTSEEDSVVDTIYDKMYENFVEEVDAVDNGISQWAEGEPRYAMTTTLSARVARLNPTWNQPNQDTEAGFRRAMDLVQEEFLQRLNFYQHSWLPARALVEEALAQRFKVDSSGEIVELAKGGCPWKEHLYHLESELSPKVAITFVIYTDQAGQWRVQCVPKEPHSFQSRLPLPEPWRGLRDKALDQVSGIPGCIFVHASGFIGGHHTREGALNMARATLAQRPAPVPLANAVVQ", "length": 380 }, "evidence": [ { "id": "P40093", "url": "https://omabrowser.org/oma/group/P40093/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P40093", "url": "https://www.uniprot.org/uniprot/P40093" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P40093", "url": "https://www.uniprot.org/uniprot/P40093" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P40093", "url": "https://www.uniprot.org/uniprot/P40093" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "positive regulation of cellular respiration", "id": "GO:1901857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901857", "evidence": [ { "database": "UniProtKB", "id": "P40093", "url": "https://www.uniprot.org/uniprot/P40093" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 280, "end_pos": 282, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }