{ "uniprot_canonical_ac": "P40013-1", "uniprot_ac": "P40013", "uniprot_id": "BIM1_YEAST", "mass": { "chemical_mass": 38362.0, "monoisotopic_mass": 38362.0 }, "refseq": { "ac": "NP_010932", "name": "microtubule-binding protein BIM1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010932" }, "gene_names": [ { "name": "BIM1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P40013", "id": "P40013" }, { "name": "BIM1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010932", "id": "NP_010932" }, { "name": "YEB1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010932", "id": "NP_010932" } ], "protein_names": [ { "name": "Protein BIM1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P40013" }, { "name": "microtubule-binding protein BIM1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010932", "id": "NP_010932" } ], "function": [ { "annotation": "Binds microtubules.", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013#function" } ] } ], "disease": [ { "disease_id": "DOID:0112243", "recommended_name": { "id": "DOID:0112243", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112243", "name": "congenital symmetric circumferential skin creases 2", "description": "A multiple benign circumferential skin creases on limbs characterized by folding of excess skin, which leads to ringed creases, primarily of the limbs, intellectual disability, cleft palate, and dysmorphic features that has_material_basis_in heterozygous mutation in the MAPRE2 gene on chromosome 18q12.1-q12.2." }, "synonyms": [ { "id": "DOID:0112243", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112243", "name": "CSCSC2", "description": "" }, { "id": "MONDO:0014755", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014755", "name": "skin creases, congenital symmetric circumferential, 2", "description": "" }, { "id": "MONDO:0014755", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014755", "name": "CSCSC2", "description": "" }, { "id": "MONDO:0014755", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014755", "name": "MAPRE2 multiple benign circumferential skin creases on limbs", "description": "" }, { "id": "MONDO:0014755", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014755", "name": "multiple benign circumferential skin creases on limbs caused by mutation in MAPRE2", "description": "" }, { "id": "MONDO:0014755", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014755", "name": "skin creases, congenital symmetric circumferential, 2", "description": "" }, { "id": "MONDO:0014755", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014755", "name": "skin creases, congenital symmetric circumferential, 2; CSCSC2", "description": "" }, { "id": "MONDO:0014755", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014755", "name": "skin creases, congenital symmetric circumferential, type 2", "description": "" }, { "id": "MONDO:0014755", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014755", "name": "symmetric circumferential skin creases, congenital, 2", "description": "" }, { "id": "MIM:616734", "resource": "MIM", "url": "https://www.omim.org/entry/616734", "name": "Skin creases, congenital symmetric circumferential, 2", "description": "Skin creases, congenital symmetric circumferential, 2" } ], "evidence": [ { "id": "0112243", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0112243" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "common_name": "Yeast" } ], "gene": [ { "name": "BIM1", "url": "https://www.uniprot.org/uniprot/P40013", "locus": { "chromosome": "V", "start_pos": 189311, "end_pos": 188277, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "YER016W", "url": "https://www.ensembl.org/id/YER016W" } ] } } ], "crossref": [ { "id": "856736", "url": "https://www.ncbi.nlm.nih.gov/gene/856736", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P40013", "url": "https://www.ebi.ac.uk/intact/interactors/id:P40013*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001715", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001715", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004953", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004953", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027328", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027328", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036133", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036133", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036872", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036872", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YER016W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YER016W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CQIYDSI", "url": "https://omabrowser.org/oma/group/CQIYDSI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "11676at2759", "url": "http://www.orthodb.org/?query=11676at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10623", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10623", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10623:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10623:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2QJX", "url": "https://www.rcsb.org/structure/2QJX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4E61", "url": "https://www.rcsb.org/structure/4E61", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6FC6", "url": "https://www.rcsb.org/structure/6FC6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF03271", "url": "http://pfam.xfam.org/family/PF03271", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P40013", "url": "http://purl.obolibrary.org/obo/PR_P40013", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010932", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010932", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000000818", "url": "https://www.yeastgenome.org/locus/S000000818", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P40013-1", "url": "https://www.uniprot.org/uniprot/P40013-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSAGIGESRTELLTWLNGLLNLNYKKIEECGTGAAYCQIMDSIYGDLPMNRVKFNATAEYEFQTNYKILQSCFSRHGIEKTVYVDKLIRCKFQDNLEFLQWLKKHWIRHKDESVYDPDARRKYRPIITNNSATKPRTVSNPTTAKRSSSTGTGSAMSGGLATRHSSLGINGSRKTSVTQGQLVAIQAELTKSQETIGSLNEEIEQYKGTVSTLEIEREFYFNKLRDIEILVHTTQDLINEGVYKFNDETITGHGNGNGGALLRFVKKVESILYATAEGFEMNDGEDELNDKNLGEHGTVPNQGGYANSNGEVNGNEGSNHDVIMQNDEGEVGVSNNLIIDEETF", "length": 344, "header": "sp|P40013-1|BIM1_YEAST Isoform 1 of Protein BIM1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=BIM1 PE=1 SV=1 CANONICAL=P40013-1" }, "isoforms": [ { "isoform_ac": "P40013-1", "url": "", "sequence": { "sequence": "MSAGIGESRTELLTWLNGLLNLNYKKIEECGTGAAYCQIMDSIYGDLPMNRVKFNATAEYEFQTNYKILQSCFSRHGIEKTVYVDKLIRCKFQDNLEFLQWLKKHWIRHKDESVYDPDARRKYRPIITNNSATKPRTVSNPTTAKRSSSTGTGSAMSGGLATRHSSLGINGSRKTSVTQGQLVAIQAELTKSQETIGSLNEEIEQYKGTVSTLEIEREFYFNKLRDIEILVHTTQDLINEGVYKFNDETITGHGNGNGGALLRFVKKVESILYATAEGFEMNDGEDELNDKNLGEHGTVPNQGGYANSNGEVNGNEGSNHDVIMQNDEGEVGVSNNLIIDEETF", "length": 344, "header": "sp|P40013-1|BIM1_YEAST Isoform 1 of Protein BIM1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=BIM1 PE=1 SV=1 CANONICAL=P40013-1" }, "locus": { "chromosome": "V", "start_pos": 189308, "end_pos": 188277, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YER016W_mRNA", "url": "https://www.ensembl.org/id/YER016W_mRNA" }, { "database": "Ensembl Peptide", "id": "YER016W", "url": "https://www.ensembl.org/id/YER016W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser139" }, { "start_pos": 147, "end_pos": 147, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" } ], "site_lbl": "Ser147" }, { "start_pos": 148, "end_pos": 148, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser148" }, { "start_pos": 149, "end_pos": 149, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser149" }, { "start_pos": 150, "end_pos": 150, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Thr150" }, { "start_pos": 152, "end_pos": 152, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" } ], "site_lbl": "Thr152" }, { "start_pos": 154, "end_pos": 154, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" } ], "site_lbl": "Ser154" }, { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" }, { "database": "PubMed", "id": "17287358", "url": "https://glygen.org/publication/PubMed/17287358" }, { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "site_lbl": "Ser157" }, { "start_pos": 162, "end_pos": 162, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" }, { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr162" }, { "start_pos": 165, "end_pos": 165, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "17287358", "url": "https://glygen.org/publication/PubMed/17287358" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser165" }, { "start_pos": 166, "end_pos": 166, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser166" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser172" }, { "start_pos": 175, "end_pos": 175, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" } ], "site_lbl": "Thr175" }, { "start_pos": 176, "end_pos": 176, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" }, { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Ser176" }, { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P40013", "url": "https://www.yeastgenome.org/locus/P40013" }, { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr249" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-02-13", "authors": "Chi An, Huttenhower Curtis, Geer Lewis Y, Coon Joshua J, Syka John E P, Bai Dina L, Shabanowitz Jeffrey, Burke Daniel J, Troyanskaya Olga G, Hunt Donald F", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" }, { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "17287358", "url": "https://glygen.org/publication/PubMed/17287358" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "J. Proteome Res.", "date": "2007", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" }, { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-06-19", "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Mol. Cell. Proteomics", "date": "2008", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" }, { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science", "date": "2009", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" }, { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "The rapamycin-sensitive phosphoproteome reveals that TOR controls protein kinase A toward some but not all substrates.", "journal": "Molecular biology of the cell", "date": "2010-10-01", "authors": "Soulard Alexandre, Cremonesi Alessio, Moes Suzette, Sch\u00fctz Fr\u00e9d\u00e9ric, Jen\u00f6 Paul, Hall Michael N", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "reference": [ { "type": "PubMed", "id": "22814378", "url": "https://glygen.org/publication/PubMed/22814378" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P40013", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40013" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome V.", "journal": "Nature", "date": "1997", "authors": "Smith V., Chen E., Guzman E., Chung E., Nakahara K., Botstein D., Davis R.W., Lin D., Wei Y., Duncan M., Berno A., Oh C., Oefner P., Taylor P., Lashkari D., Allen E., Hyman R.W., Araujo R., Komp C., Lew H., Namath A., Roberts D., Mulligan J.T., Sehl P., Schramm S., Hartzell G., Cherry J.M., Dietrich F.S., Aviles E., Brennan T., Carpenter J., Hennessy K.M., Hunicke-Smith S., Kayser A., Mosedale D., Norgren R., Petel F.X., Shogren T., Yelton M.A.", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "reference": [ { "type": "PubMed", "id": "9169868", "url": "https://glygen.org/publication/PubMed/9169868" } ] }, { "title": "BIM1 encodes a microtubule-binding protein in yeast.", "journal": "Mol. Biol. Cell", "date": "1997", "authors": "Schwartz K., Botstein D., Richards K.", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "reference": [ { "type": "PubMed", "id": "9398684", "url": "https://glygen.org/publication/PubMed/9398684" } ] } ], "pathway": [ { "id": "sce:YER016W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YER016W", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q15555-1", "protein_name": "Microtubule-associated protein RP/EB family member 2", "gene_name": "MAPRE2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY", "length": 327 }, "evidence": [ { "id": "P40013", "url": "https://omabrowser.org/oma/group/P40013/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8R001-1", "protein_name": "Microtubule-associated protein RP/EB family member 2", "gene_name": "Mapre2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPGPTQTLSPNGENNNDIIQDNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSRPSSAKRASSSGSASRSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMEVLYASDEQEGQTEEPEAEEQAHDQQPQQQEEY", "length": 326 }, "evidence": [ { "id": "P40013", "url": "https://omabrowser.org/oma/group/P40013/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "regulation of microtubule polymerization or depolymerization", "id": "GO:0031110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031110", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "negative regulation of microtubule depolymerization", "id": "GO:0007026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007026", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "positive regulation of microtubule polymerization", "id": "GO:0031116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031116", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "spindle assembly", "id": "GO:0051225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051225", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "microtubule depolymerization", "id": "GO:0007019", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007019", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "mitotic sister chromatid cohesion", "id": "GO:0007064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007064", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "protein localization to microtubule", "id": "GO:0035372", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035372", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "protein localization to microtubule plus-end", "id": "GO:1904825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904825", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "nuclear migration along microtubule", "id": "GO:0030473", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030473", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "2-micrometer plasmid partitioning", "id": "GO:0030543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030543", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "mitotic spindle orientation checkpoint signaling", "id": "GO:0031578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031578", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "spindle pole", "id": "GO:0000922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000922", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "spindle midzone", "id": "GO:0051233", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051233", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "microtubule organizing center", "id": "GO:0005815", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005815", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "cytoplasmic microtubule", "id": "GO:0005881", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005881", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "microtubule plus-end", "id": "GO:0035371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035371", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" }, { "name": "mitotic spindle", "id": "GO:0072686", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072686", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "microtubule plus-end binding", "id": "GO:0051010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051010", "evidence": [ { "database": "UniProtKB", "id": "P40013", "url": "https://www.uniprot.org/uniprot/P40013" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 129, "end_pos": 131, "annotation": "n_glycosylation_sequon" }, { "start_pos": 170, "end_pos": 172, "annotation": "n_glycosylation_sequon" }, { "start_pos": 55, "end_pos": 57, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 15 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }