{ "uniprot_canonical_ac": "P39111-1", "uniprot_ac": "P39111", "uniprot_id": "VATF_YEAST", "mass": { "chemical_mass": 13461.0, "monoisotopic_mass": 13461.0 }, "refseq": { "ac": "NP_011534", "name": "H(+)-transporting V1 sector ATPase subunit F", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011534" }, "gene_names": [ { "name": "VMA7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P39111", "id": "P39111" }, { "name": "VMA7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011534", "id": "NP_011534" } ], "protein_names": [ { "name": "V-type proton ATPase subunit F", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P39111" }, { "name": "H(+)-transporting V1 sector ATPase subunit F", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011534", "id": "NP_011534" }, { "name": "V-ATPase 14 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P39111" }, { "name": "V-ATPase subunit F", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P39111" }, { "name": "Vacuolar proton pump subunit F", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P39111" } ], "function": [ { "annotation": "Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed:7929071). V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments (PubMed:7929071).", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111#function" }, { "database": "PubMed", "id": "7929071", "url": "https://glygen.org/publication/PubMed/7929071" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "common_name": "Yeast" } ], "gene": [ { "name": "VMA7", "url": "https://www.uniprot.org/uniprot/P39111", "locus": {} } ], "crossref": [ { "id": "852903", "url": "https://www.ncbi.nlm.nih.gov/gene/852903", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P39111", "url": "https://www.ebi.ac.uk/intact/interactors/id:P39111*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005772", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005772", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008218", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008218", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036906", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036906", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YGR020C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR020C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "INQNYAE", "url": "https://omabrowser.org/oma/group/INQNYAE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "275186at2759", "url": "http://www.orthodb.org/?query=275186at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13861", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13861", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13861:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13861:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3J9T", "url": "https://www.rcsb.org/structure/3J9T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3J9U", "url": "https://www.rcsb.org/structure/3J9U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3J9V", "url": "https://www.rcsb.org/structure/3J9V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IX9", "url": "https://www.rcsb.org/structure/4IX9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4RND", "url": "https://www.rcsb.org/structure/4RND", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5D80", "url": "https://www.rcsb.org/structure/5D80", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VOX", "url": "https://www.rcsb.org/structure/5VOX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VOY", "url": "https://www.rcsb.org/structure/5VOY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VOZ", "url": "https://www.rcsb.org/structure/5VOZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6O7V", "url": "https://www.rcsb.org/structure/6O7V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6O7W", "url": "https://www.rcsb.org/structure/6O7W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6O7X", "url": "https://www.rcsb.org/structure/6O7X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FDA", "url": "https://www.rcsb.org/structure/7FDA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FDB", "url": "https://www.rcsb.org/structure/7FDB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FDC", "url": "https://www.rcsb.org/structure/7FDC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FDE", "url": "https://www.rcsb.org/structure/7FDE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TMM", "url": "https://www.rcsb.org/structure/7TMM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TMO", "url": "https://www.rcsb.org/structure/7TMO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TMP", "url": "https://www.rcsb.org/structure/7TMP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TMQ", "url": "https://www.rcsb.org/structure/7TMQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TMR", "url": "https://www.rcsb.org/structure/7TMR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01990", "url": "http://pfam.xfam.org/family/PF01990", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P39111", "url": "http://purl.obolibrary.org/obo/PR_P39111", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_011534", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011534", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000003252", "url": "https://www.yeastgenome.org/locus/S000003252", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P39111-1", "url": "https://www.uniprot.org/uniprot/P39111-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEKRTLIAVIADEDTTTGLLLAGIGQITPETQEKNFFVYQEGKTTKEEITDKFNHFTEERDDIAILLINQHIAENIRARVDSFTNAFPAILEIPSKDHPYDPEKDSVLKRVRKLFGE", "length": 118, "header": "sp|P39111-1|VATF_YEAST Isoform 1 of V-type proton ATPase subunit F OS=Saccharomyces cerevisiae S288C OX=559292 GN=VMA7 PE=1 SV=1 CANONICAL=P39111-1" }, "isoforms": [ { "isoform_ac": "P39111-1", "url": "", "sequence": { "sequence": "MAEKRTLIAVIADEDTTTGLLLAGIGQITPETQEKNFFVYQEGKTTKEEITDKFNHFTEERDDIAILLINQHIAENIRARVDSFTNAFPAILEIPSKDHPYDPEKDSVLKRVRKLFGE", "length": 118, "header": "sp|P39111-1|VATF_YEAST Isoform 1 of V-type proton ATPase subunit F OS=Saccharomyces cerevisiae S288C OX=559292 GN=VMA7 PE=1 SV=1 CANONICAL=P39111-1" }, "locus": { "chromosome": "VII", "start_pos": 527329, "end_pos": 526976, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YGR020C_mRNA", "url": "https://www.ensembl.org/id/YGR020C_mRNA" }, { "database": "Ensembl Peptide", "id": "YGR020C", "url": "https://www.ensembl.org/id/YGR020C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Stoichiometry of the peripheral stalk subunits E and G of yeast V1-ATPase determined by mass spectrometry.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Heck A.J.R., Wilkens S., Kitagawa N., Mazon H.", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "reference": [ { "type": "PubMed", "id": "18055462", "url": "https://glygen.org/publication/PubMed/18055462" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Electron cryomicroscopy observation of rotational states in a eukaryotic V-ATPase.", "journal": "Nature", "date": "2015", "authors": "Zhao J., Rubinstein J.L., Benlekbir S.", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "reference": [ { "type": "PubMed", "id": "25971514", "url": "https://glygen.org/publication/PubMed/25971514" } ] }, { "title": "Crystal structure of yeast V1-ATPase in the autoinhibited state.", "journal": "EMBO J.", "date": "2016", "authors": "Oot Rebecca A, Kane Patricia M, Berry Edward A, Wilkens Stephan", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "reference": [ { "type": "PubMed", "id": "27295975", "url": "https://glygen.org/publication/PubMed/27295975" } ] }, { "title": "The Saccharomyces cerevisiae VMA7 gene encodes a 14-kDa subunit of the vacuolar H(+)-ATPase catalytic sector.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Nelson N., Mandiyan S., Nelson H.", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "reference": [ { "type": "PubMed", "id": "7929071", "url": "https://glygen.org/publication/PubMed/7929071" } ] }, { "title": "VMA7 encodes a novel 14-kDa subunit of the Saccharomyces cerevisiae vacuolar H(+)-ATPase complex.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Hill K.J., Graham L.A., Stevens T.H.", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "reference": [ { "type": "PubMed", "id": "7929308", "url": "https://glygen.org/publication/PubMed/7929308" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII.", "journal": "Nature", "date": "1997", "authors": "Mewes H.-W., Minenkova O., Schaefer M., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Hansen M., Rose M., Durand P., Brueckner M., Plevani P., Netter P., Rieger M., Zimmermann M., Portetelle D., Wolf K., Bertani I., Delius H., Kleine K., Portillo F., Hofmann B., Albers M., Schaefer B., Kramer W., Castagnoli L., Volckaert G., Koetter P., Entian K.-D., Kramer B., Rinaldi T., Thierry A., Louis E.J., Vandenbol M., Martegani E., Robben J., Nombela C., Vanoni M., Arroyo J., Eraso P., Mazon M.J., James C.M., Carignani G., Dujon B., Feuermann M., Goffeau A., Hani J., Hilger F., Klima R., Mueller-Auer S., Oliver S.G., Potier S., Rodrigues-Pousada C., Schmidheini T., Souciet J.-L., Steensma H.Y., Zollner A., Bruschi C.V., Escribano V., Frontali L., Guerreiro P., Mazzoni C., Purnelle B., Rodriguez-Torres A.M., Skala J., Talla E., Voet M., de Wergifosse P., Agostoni-Carbone M.L., Albermann K., Backes U., Barreiros T., Bjourson A.J., Cerdan E., Clemente M.L., Coblenz A., Coglievina M., Coissac E., Defoor E., Del Bino S., Delneri D., Fabiani L., Fartmann B., Feroli F., Garcia-Gonzalez M., Garcia-Saez M.I., Hebling U., Hernandez K., Heumann K., Indge K.J., Lauquin G., Leuther H., Maillier E., Marconi A., McReynolds A.D.K., Melchioretto P., Nawrocki A., Neu R., Panzeri L., Paoluzi S., Riles L., Rodriguez-Belmonte E., Ruzzi M., Saliola M., Sanchez-Perez M., Schreer A., Tettelin H., Van Dyck L., Watson M.D., Weber N., Wedler E., Wipfli P., Wright L.F., Zaccaria P., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "reference": [ { "type": "PubMed", "id": "9169869", "url": "https://glygen.org/publication/PubMed/9169869" } ] }, { "title": "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII.", "journal": "Yeast", "date": "1997", "authors": "Rieger M, Br\u00fcckner M, Sch\u00e4fer M, M\u00fcller-Auer S", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "reference": [ { "type": "PubMed", "id": "9290212", "url": "https://glygen.org/publication/PubMed/9290212" } ] } ], "pathway": [ { "id": "sce:YGR020C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR020C", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q16864-1", "protein_name": "V-type proton ATPase subunit F", "gene_name": "ATP6V1F", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR", "length": 119 }, "evidence": [ { "id": "P39111", "url": "https://omabrowser.org/oma/group/P39111/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q24583-1", "protein_name": "V-type proton ATPase subunit F 1", "gene_name": "Vha14-1", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MALHSAIKGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSELEDCFKRFLKRDDIDIILINQNCAELIRHVIDAHTSPVPAVLEIPSKDHPYDASKDSILRRARGMFNPEDLVR", "length": 124 }, "evidence": [ { "id": "P39111", "url": "https://omabrowser.org/oma/group/P39111/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9D1K2-1", "protein_name": "V-type proton ATPase subunit F", "gene_name": "Atp6v1f", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR", "length": 119 }, "evidence": [ { "id": "P39111", "url": "https://omabrowser.org/oma/group/P39111/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "proton-transporting V-type ATPase complex", "id": "GO:0033176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033176", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "pmid": "" }, { "name": "vacuolar proton-transporting V-type ATPase complex", "id": "GO:0016471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016471", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "pmid": "" }, { "name": "vacuolar proton-transporting V-type ATPase, V1 domain", "id": "GO:0000221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000221", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "pmid": "" }, { "name": "fungal-type vacuole membrane", "id": "GO:0000329", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000329", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "endosomal lumen acidification", "id": "GO:0048388", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048388", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "pmid": "" }, { "name": "vacuolar acidification", "id": "GO:0007035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007035", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "pmid": "" }, { "name": "proton transmembrane transport", "id": "GO:1902600", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902600", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "pmid": "" }, { "name": "Golgi lumen acidification", "id": "GO:0061795", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061795", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "proton-transporting ATPase activity, rotational mechanism", "id": "GO:0046961", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046961", "evidence": [ { "database": "UniProtKB", "id": "P39111", "url": "https://www.uniprot.org/uniprot/P39111" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }