{
    "uniprot_canonical_ac": "P39079-1",
    "uniprot_ac": "P39079",
    "uniprot_id": "TCPZ_YEAST",
    "mass": {
        "chemical_mass": 59924.0,
        "monoisotopic_mass": 59924.0
    },
    "refseq": {
        "ac": "NP_010474",
        "name": "chaperonin-containing T-complex subunit CCT6",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010474"
    },
    "gene_names": [
        {
            "name": "CCT6",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P39079",
            "id": "P39079"
        },
        {
            "name": "CCT6",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010474",
            "id": "NP_010474"
        },
        {
            "name": "HTR3; TCP20; TCP6",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010474",
            "id": "NP_010474"
        },
        {
            "name": "TCP20",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P39079",
            "id": "P39079"
        },
        {
            "name": "TCP6",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P39079",
            "id": "P39079"
        },
        {
            "name": "YD9395.21",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P39079",
            "id": "P39079"
        }
    ],
    "protein_names": [
        {
            "name": "T-complex protein 1 subunit zeta",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P39079"
        },
        {
            "name": "CCT-zeta",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P39079"
        },
        {
            "name": "TCP-1-zeta",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P39079"
        },
        {
            "name": "chaperonin-containing T-complex subunit CCT6",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010474",
            "id": "NP_010474"
        }
    ],
    "function": [
        {
            "annotation": "Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. Known to play a role, in vitro, in the folding of actin and tubulin. In yeast may play a role in mitotic spindle formation.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P39079",
                    "url": "https://www.uniprot.org/uniprot/P39079#function"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0060036",
            "recommended_name": {
                "id": "DOID:0060036",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0060036",
                "name": "intrinsic cardiomyopathy",
                "description": "A cardiomyopathy that is characterized as weakness in the muscle of the heart that is not due to an identifiable external cause."
            },
            "synonyms": [],
            "evidence": [
                {
                    "id": "0060036",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0060036"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P39079",
                    "url": "https://www.uniprot.org/uniprot/P39079"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "CCT6",
            "url": "https://www.uniprot.org/uniprot/P39079",
            "locus": {
                "chromosome": "IV",
                "start_pos": 838061,
                "end_pos": 836421,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "YDR188W",
                        "url": "https://www.ensembl.org/id/YDR188W"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "3.6.4.B10",
            "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.6.4.B10&UniProtAcc=P39079",
            "database": "BRENDA",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "cd03342",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03342",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "851768",
            "url": "https://www.ncbi.nlm.nih.gov/gene/851768",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "P39079",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P39079*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR002194",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002194",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR002423",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002423",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR012722",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR012722",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017998",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017998",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR027409",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR027409",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR027410",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR027410",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR027413",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR027413",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YDR188W",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR188W",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "LHPRIMT",
            "url": "https://omabrowser.org/oma/group/LHPRIMT/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1058698at2759",
            "url": "http://www.orthodb.org/?query=1058698at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11353",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11353",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11353:SF21",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11353:SF21",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4V81",
            "url": "https://www.rcsb.org/structure/4V81",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4V8R",
            "url": "https://www.rcsb.org/structure/4V8R",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4V94",
            "url": "https://www.rcsb.org/structure/4V94",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5GW4",
            "url": "https://www.rcsb.org/structure/5GW4",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5GW5",
            "url": "https://www.rcsb.org/structure/5GW5",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6KRD",
            "url": "https://www.rcsb.org/structure/6KRD",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6KRE",
            "url": "https://www.rcsb.org/structure/6KRE",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6KS6",
            "url": "https://www.rcsb.org/structure/6KS6",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6KS7",
            "url": "https://www.rcsb.org/structure/6KS7",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6KS8",
            "url": "https://www.rcsb.org/structure/6KS8",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7YLU",
            "url": "https://www.rcsb.org/structure/7YLU",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7YLV",
            "url": "https://www.rcsb.org/structure/7YLV",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7YLW",
            "url": "https://www.rcsb.org/structure/7YLW",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7YLX",
            "url": "https://www.rcsb.org/structure/7YLX",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7YLY",
            "url": "https://www.rcsb.org/structure/7YLY",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF00118",
            "url": "http://pfam.xfam.org/family/PF00118",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P39079",
            "url": "http://purl.obolibrary.org/obo/PR_P39079",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_010474",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010474",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000002596",
            "url": "https://www.yeastgenome.org/locus/S000002596",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P39079",
            "url": "https://www.uniprot.org/uniprot/P39079",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P39079-1",
            "url": "https://www.uniprot.org/uniprot/P39079-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSLQLLNPKAESLRRDAALKVNVTSAEGLQSVLETNLGPKGTLKMLVDGAGNIKLTKDGKVLLTEMQIQSPTAVLIARAAAAQDEITGDGTTTVVCLVGELLRQAHRFIQEGVHPRIITDGFEIARKESMKFLDEFKISKTNLSNDREFLLQVARSSLLTKVDADLTEVLTPIVTDAVLSVYDAQADNLDLHMVEIMQMQHLSPKDTTFIKGLVLDHGGRHPDMPTRVKNAYVLILNVSLEYEKTEVNSGFFYSSADQRDKLAASERKFVDAKLKKIIDLKNEVCGMDPDKGFVIINQKGIDPMSLDVFAKHNILALRRAKRRNMERLQLVTGGEAQNSVEDLSPQILGFSGLVYQETIGEEKFTYVTENTDPKSCTILIKGSTHYALAQTKDAVRDGLRAVANVLKDKNIIPGAGAFYIALSRYLRSANMNKLGAKGKTKTGIEAFAEALLVIPKTLVKNSGFDPLDVLAMVEDELDDAQDSDETRYVGVDLNIGDSCDPTIEGIWDSYRVLRNAITGATGIASNLLLCDELLRAGRSTLKETPQ",
        "length": 546,
        "header": "sp|P39079-1|TCPZ_YEAST Isoform 1 of T-complex protein 1 subunit zeta  OS=Saccharomyces cerevisiae S288C OX=559292 GN=CCT6 PE=1 SV=1 CANONICAL=P39079-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P39079-1",
            "url": "",
            "sequence": {
                "sequence": "MSLQLLNPKAESLRRDAALKVNVTSAEGLQSVLETNLGPKGTLKMLVDGAGNIKLTKDGKVLLTEMQIQSPTAVLIARAAAAQDEITGDGTTTVVCLVGELLRQAHRFIQEGVHPRIITDGFEIARKESMKFLDEFKISKTNLSNDREFLLQVARSSLLTKVDADLTEVLTPIVTDAVLSVYDAQADNLDLHMVEIMQMQHLSPKDTTFIKGLVLDHGGRHPDMPTRVKNAYVLILNVSLEYEKTEVNSGFFYSSADQRDKLAASERKFVDAKLKKIIDLKNEVCGMDPDKGFVIINQKGIDPMSLDVFAKHNILALRRAKRRNMERLQLVTGGEAQNSVEDLSPQILGFSGLVYQETIGEEKFTYVTENTDPKSCTILIKGSTHYALAQTKDAVRDGLRAVANVLKDKNIIPGAGAFYIALSRYLRSANMNKLGAKGKTKTGIEAFAEALLVIPKTLVKNSGFDPLDVLAMVEDELDDAQDSDETRYVGVDLNIGDSCDPTIEGIWDSYRVLRNAITGATGIASNLLLCDELLRAGRSTLKETPQ",
                "length": 546,
                "header": "sp|P39079-1|TCPZ_YEAST Isoform 1 of T-complex protein 1 subunit zeta  OS=Saccharomyces cerevisiae S288C OX=559292 GN=CCT6 PE=1 SV=1 CANONICAL=P39079-1"
            },
            "locus": {
                "chromosome": "IV",
                "start_pos": 838058,
                "end_pos": 836421,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YDR188W_mRNA",
                        "url": "https://www.ensembl.org/id/YDR188W_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YDR188W",
                        "url": "https://www.ensembl.org/id/YDR188W"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 249,
            "end_pos": 249,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P39079",
                    "url": "https://www.uniprot.org/uniprot/P39079"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "iPTMnet",
                    "id": "P39079",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39079"
                },
                {
                    "database": "SGD",
                    "id": "P39079",
                    "url": "https://www.yeastgenome.org/locus/P39079"
                }
            ],
            "site_lbl": "Ser249"
        },
        {
            "start_pos": 544,
            "end_pos": 544,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "SGD",
                    "id": "P39079",
                    "url": "https://www.yeastgenome.org/locus/P39079"
                },
                {
                    "database": "iPTMnet",
                    "id": "P39079",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39079"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Thr544"
        },
        {
            "start_pos": 64,
            "end_pos": 64,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P39079",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39079"
                },
                {
                    "database": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ],
            "site_lbl": "Thr64"
        },
        {
            "start_pos": 70,
            "end_pos": 70,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "SGD",
                    "id": "P39079",
                    "url": "https://www.yeastgenome.org/locus/P39079"
                },
                {
                    "database": "iPTMnet",
                    "id": "P39079",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39079"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                }
            ],
            "site_lbl": "Ser70"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2008-07",
            "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P39079",
                    "url": "https://www.uniprot.org/uniprot/P39079"
                },
                {
                    "database": "iPTMnet",
                    "id": "P39079",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39079"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                }
            ]
        },
        {
            "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.",
            "journal": "BMC genomics",
            "date": "2010-12-02",
            "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P39079",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39079"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ]
        },
        {
            "title": "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2012",
            "authors": "Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P39079",
                    "url": "https://www.uniprot.org/uniprot/P39079"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22814378",
                    "url": "https://glygen.org/publication/PubMed/22814378"
                }
            ]
        },
        {
            "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.",
            "journal": "Nature methods",
            "date": "2013-07",
            "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P39079",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39079"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P39079",
                    "url": "https://www.uniprot.org/uniprot/P39079"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "Tcp20, a subunit of the eukaryotic TRiC chaperonin from humans and yeast.",
            "journal": "J. Biol. Chem.",
            "date": "1994",
            "authors": "Li WZ, Lin P, Frydman J, Boal TR, Cardillo TS, Richard LM, Toth D, Lichtman MA, Hartl FU, Sherman F, et al.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P39079",
                    "url": "https://www.uniprot.org/uniprot/P39079"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8034610",
                    "url": "https://glygen.org/publication/PubMed/8034610"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P39079",
                    "url": "https://www.uniprot.org/uniprot/P39079"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169867",
                    "url": "https://glygen.org/publication/PubMed/9169867"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YDR188W",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR188W",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P40227-1",
            "protein_name": "T-complex protein 1 subunit zeta",
            "gene_name": "CCT6A",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPFSLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAEALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVDLNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG",
                "length": 531
            },
            "evidence": [
                {
                    "id": "P39079",
                    "url": "https://omabrowser.org/oma/group/P39079/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 4,
                "go_terms": [
                    {
                        "name": "ATP binding",
                        "id": "GO:0005524",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P39079",
                                "url": "https://www.uniprot.org/uniprot/P39079"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "unfolded protein binding",
                        "id": "GO:0051082",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051082",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P39079",
                                "url": "https://www.uniprot.org/uniprot/P39079"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ATP hydrolysis activity",
                        "id": "GO:0016887",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P39079",
                                "url": "https://www.uniprot.org/uniprot/P39079"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ATP-dependent protein folding chaperone",
                        "id": "GO:0140662",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140662",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P39079",
                                "url": "https://www.uniprot.org/uniprot/P39079"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "protein folding",
                        "id": "GO:0006457",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006457",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P39079",
                                "url": "https://www.uniprot.org/uniprot/P39079"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "chaperone mediated protein folding independent of cofactor",
                        "id": "GO:0051086",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051086",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P39079",
                                "url": "https://www.uniprot.org/uniprot/P39079"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "chaperonin-containing T-complex",
                        "id": "GO:0005832",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005832",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P39079",
                                "url": "https://www.uniprot.org/uniprot/P39079"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 142,
            "end_pos": 144,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 22,
            "end_pos": 24,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 237,
            "end_pos": 239,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                },
                {
                    "field": "total_sites",
                    "count": 4
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}