{ "uniprot_canonical_ac": "P38988-1", "uniprot_ac": "P38988", "uniprot_id": "GGC1_YEAST", "mass": { "chemical_mass": 33215.0, "monoisotopic_mass": 33215.0 }, "refseq": { "ac": "NP_010083", "name": "Ggc1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010083" }, "gene_names": [ { "name": "GGC1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P38988", "id": "P38988" }, { "name": "D1214", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P38988", "id": "P38988" }, { "name": "GGC1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010083", "id": "NP_010083" }, { "name": "SHM1; YHM1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010083", "id": "NP_010083" }, { "name": "SHM1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P38988", "id": "P38988" }, { "name": "YHM1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P38988", "id": "P38988" } ], "protein_names": [ { "name": "Mitochondrial GTP/GDP carrier protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P38988" }, { "name": "Ggc1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010083", "id": "NP_010083" } ], "function": [ { "annotation": "Mitochondrial GTP/GDP transporter required for GTP uptake and GDP exit from mitochondria. Involved in mitochondrial iron transport and essential for mitochondrial genome maintenance.", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988#function" }, { "database": "PubMed", "id": "14629196", "url": "https://glygen.org/publication/PubMed/14629196" }, { "database": "PubMed", "id": "14998997", "url": "https://glygen.org/publication/PubMed/14998997" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "common_name": "Yeast" } ], "gene": [ { "name": "GGC1", "url": "https://www.uniprot.org/uniprot/P38988", "locus": { "chromosome": "IV", "start_pos": 103649, "end_pos": 104551, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "YDL198C", "url": "https://www.ensembl.org/id/YDL198C" } ] } } ], "crossref": [ { "id": "851329", "url": "https://www.ncbi.nlm.nih.gov/gene/851329", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P38988", "url": "https://www.ebi.ac.uk/intact/interactors/id:P38988*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR018108", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018108", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023395", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023395", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YDL198C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDL198C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NKATWGQ", "url": "https://omabrowser.org/oma/group/NKATWGQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "126327at2759", "url": "http://www.orthodb.org/?query=126327at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46974", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46974", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46974:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46974:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00153", "url": "http://pfam.xfam.org/family/PF00153", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P38988", "url": "http://purl.obolibrary.org/obo/PR_P38988", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010083", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010083", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002357", "url": "https://www.yeastgenome.org/locus/S000002357", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P38988-1", "url": "https://www.uniprot.org/uniprot/P38988-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLSK", "length": 300, "header": "sp|P38988-1|GGC1_YEAST Isoform 1 of Mitochondrial GTP/GDP carrier protein 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=GGC1 PE=1 SV=1 CANONICAL=P38988-1" }, "isoforms": [ { "isoform_ac": "P38988-1", "url": "", "sequence": { "sequence": "MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLSK", "length": 300, "header": "sp|P38988-1|GGC1_YEAST Isoform 1 of Mitochondrial GTP/GDP carrier protein 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=GGC1 PE=1 SV=1 CANONICAL=P38988-1" }, "locus": { "chromosome": "IV", "start_pos": 104551, "end_pos": 103652, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YDL198C_mRNA", "url": "https://www.ensembl.org/id/YDL198C_mRNA" }, { "database": "Ensembl Peptide", "id": "YDL198C", "url": "https://www.ensembl.org/id/YDL198C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The proteome of Saccharomyces cerevisiae mitochondria.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2003", "authors": "Sickmann A., Zahedi R.P., Rehling P., Chacinska A., Guiard B., Meyer H.E., Meisinger C., Reinders J., Pfanner N., Joppich C., Perschil I., Schoenfisch B., Wagner Y.", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "reference": [ { "type": "PubMed", "id": "14576278", "url": "https://glygen.org/publication/PubMed/14576278" } ] }, { "title": "Role of YHM1, encoding a mitochondrial carrier protein, in iron distribution of yeast.", "journal": "Biochem. J.", "date": "2004", "authors": "Dancis A., Knight S.A., Lesuisse E., Lyver E.R.", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "reference": [ { "type": "PubMed", "id": "14629196", "url": "https://glygen.org/publication/PubMed/14629196" } ] }, { "title": "Identification of the mitochondrial GTP/GDP transporter in Saccharomyces cerevisiae.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Palmieri F., Palmieri L., Blanco E., Vozza A.", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "reference": [ { "type": "PubMed", "id": "14998997", "url": "https://glygen.org/publication/PubMed/14998997" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "reference": [ { "type": "PubMed", "id": "22814378", "url": "https://glygen.org/publication/PubMed/22814378" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The sequence of 23 kb surrounding the SNF3 locus on the left arm of yeast chromosome IV reveals the location of five known genes and characterizes at least six new open reading frames including putative genes for ribosomal protein L35 and a sugar transport protein.", "journal": "Yeast", "date": "1996", "authors": "Verhasselt P., Volckaert G., Mathys J., Voet M.", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "reference": [ { "type": "PubMed", "id": "8896272", "url": "https://glygen.org/publication/PubMed/8896272" } ] }, { "title": "SHM1: a multicopy suppressor of a temperature-sensitive null mutation in the HMG1-like abf2 gene.", "journal": "Yeast", "date": "1996", "authors": "Megraw T.L., Chae C.-B., Kao L.-R.", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "reference": [ { "type": "PubMed", "id": "8905928", "url": "https://glygen.org/publication/PubMed/8905928" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] } ], "pathway": [ { "id": "sce:YDL198C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDL198C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "transmembrane transport", "id": "GO:0055085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "pmid": "" }, { "name": "intracellular iron ion homeostasis", "id": "GO:0006879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006879", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "pmid": "" }, { "name": "mitochondrial genome maintenance", "id": "GO:0000002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000002", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "pmid": "" }, { "name": "guanine nucleotide transport", "id": "GO:0001408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001408", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "guanine nucleotide transmembrane transporter activity", "id": "GO:0001409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001409", "evidence": [ { "database": "UniProtKB", "id": "P38988", "url": "https://www.uniprot.org/uniprot/P38988" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 41, "end_pos": 43, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }