{ "uniprot_canonical_ac": "P38953-1", "uniprot_ac": "P38953", "uniprot_id": "RAD55_YEAST", "mass": { "chemical_mass": 46350.0, "monoisotopic_mass": 46350.0 }, "refseq": { "ac": "NP_010361", "name": "putative DNA-dependent ATPase RAD55", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010361" }, "gene_names": [ { "name": "RAD55", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P38953", "id": "P38953" }, { "name": "D4426", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P38953", "id": "P38953" }, { "name": "RAD55", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010361", "id": "NP_010361" } ], "protein_names": [ { "name": "DNA repair protein RAD55", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P38953" }, { "name": "putative DNA-dependent ATPase RAD55", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010361", "id": "NP_010361" } ], "function": [ { "annotation": "Required for radiation resistance and meiotic viability and presumably acts in recombination and recombinational DNA repair pathways.", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "common_name": "Yeast" } ], "gene": [ { "name": "RAD55", "url": "https://www.uniprot.org/uniprot/P38953", "locus": {} } ], "crossref": [ { "id": "851648", "url": "https://www.ncbi.nlm.nih.gov/gene/851648", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P38953", "url": "https://www.ebi.ac.uk/intact/interactors/id:P38953*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013632", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013632", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020588", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020588", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YDR076W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR076W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TIHELKC", "url": "https://omabrowser.org/oma/group/TIHELKC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2035832at2759", "url": "http://www.orthodb.org/?query=2035832at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46239", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46239", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46239:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46239:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08423", "url": "http://pfam.xfam.org/family/PF08423", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P38953", "url": "http://purl.obolibrary.org/obo/PR_P38953", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010361", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010361", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002483", "url": "https://www.yeastgenome.org/locus/S000002483", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P38953-1", "url": "https://www.uniprot.org/uniprot/P38953-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSLGIPLSQLIVESPKPLSSGITGLDEILNLGFQARSIYEIFGPPGIGKTNFGIQLVCNSLEGIQQSEINDDKILWIETFQEMPINILRERFQKFKIVEENVKRVRITKFGQLLYFFQNLFKLSQSVRYKLVIIDGFSQLVCDHLCTLSKRGGGMIDKTIHELKCRHLILIFTVMTKYTHSTGSTIIVLNDCMNTAFQSNEFESLEEYYEILDDGSNFFVNSNNERRKNNVHILKSALVANIAMGSKDSTWEVFLRDRIGLFRDWNEQVDETVFVKSKRVKASSSQSNEGCTTIKEMRINKRNFENLRIAIVFNLHGEDRKREGRNLKRSRSSDDRNYIVKFDFDKATGQLRDIIDLKPDTANIASFPTLSTSSSSCSQVFNNIDSNDNPLPNAEGKEEIIYDSEG", "length": 406, "header": "sp|P38953-1|RAD55_YEAST Isoform 1 of DNA repair protein RAD55 OS=Saccharomyces cerevisiae S288C OX=559292 GN=RAD55 PE=1 SV=1 CANONICAL=P38953-1" }, "isoforms": [ { "isoform_ac": "P38953-1", "url": "", "sequence": { "sequence": "MSLGIPLSQLIVESPKPLSSGITGLDEILNLGFQARSIYEIFGPPGIGKTNFGIQLVCNSLEGIQQSEINDDKILWIETFQEMPINILRERFQKFKIVEENVKRVRITKFGQLLYFFQNLFKLSQSVRYKLVIIDGFSQLVCDHLCTLSKRGGGMIDKTIHELKCRHLILIFTVMTKYTHSTGSTIIVLNDCMNTAFQSNEFESLEEYYEILDDGSNFFVNSNNERRKNNVHILKSALVANIAMGSKDSTWEVFLRDRIGLFRDWNEQVDETVFVKSKRVKASSSQSNEGCTTIKEMRINKRNFENLRIAIVFNLHGEDRKREGRNLKRSRSSDDRNYIVKFDFDKATGQLRDIIDLKPDTANIASFPTLSTSSSSCSQVFNNIDSNDNPLPNAEGKEEIIYDSEG", "length": 406, "header": "sp|P38953-1|RAD55_YEAST Isoform 1 of DNA repair protein RAD55 OS=Saccharomyces cerevisiae S288C OX=559292 GN=RAD55 PE=1 SV=1 CANONICAL=P38953-1" }, "locus": { "chromosome": "IV", "start_pos": 599685, "end_pos": 598468, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YDR076W_mRNA", "url": "https://www.ensembl.org/id/YDR076W_mRNA" }, { "database": "Ensembl Peptide", "id": "YDR076W", "url": "https://www.ensembl.org/id/YDR076W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" }, { "database": "PubMed", "id": "16966380", "url": "https://glygen.org/publication/PubMed/16966380" }, { "database": "PubMed", "id": "20061370", "url": "https://glygen.org/publication/PubMed/20061370" }, { "database": "SGD", "id": "P38953", "url": "https://www.yeastgenome.org/locus/P38953" } ], "site_lbl": "Ser14" }, { "start_pos": 285, "end_pos": 285, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P38953", "url": "https://www.yeastgenome.org/locus/P38953" }, { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser285" }, { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P38953", "url": "https://www.yeastgenome.org/locus/P38953" } ], "site_lbl": "Ser287" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" }, { "database": "PubMed", "id": "16966380", "url": "https://glygen.org/publication/PubMed/16966380" }, { "database": "PubMed", "id": "20061370", "url": "https://glygen.org/publication/PubMed/20061370" }, { "database": "SGD", "id": "P38953", "url": "https://www.yeastgenome.org/locus/P38953" } ], "site_lbl": "Ser2" }, { "start_pos": 378, "end_pos": 378, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" }, { "database": "PubMed", "id": "16793401", "url": "https://glygen.org/publication/PubMed/16793401" }, { "database": "PubMed", "id": "20061370", "url": "https://glygen.org/publication/PubMed/20061370" } ], "site_lbl": "Ser378" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" }, { "database": "PubMed", "id": "16966380", "url": "https://glygen.org/publication/PubMed/16966380" }, { "database": "PubMed", "id": "20061370", "url": "https://glygen.org/publication/PubMed/20061370" }, { "database": "SGD", "id": "P38953", "url": "https://www.yeastgenome.org/locus/P38953" } ], "site_lbl": "Ser8" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "DNA damage-induced phosphorylation of Rad55 protein as a sentinel for DNA damage checkpoint activation in S. cerevisiae.", "journal": "Methods in enzymology", "date": "2006", "authors": "Bashkirov Vladimir I, Herzberg Kristina, Haghnazari Edwin, Vlasenko Alexey S, Heyer Wolf-Dietrich", "evidence": [ { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" } ], "reference": [ { "type": "PubMed", "id": "16793401", "url": "https://glygen.org/publication/PubMed/16793401" } ] }, { "title": "Phosphorylation of Rad55 on serines 2, 8, and 14 is required for efficient homologous recombination in the recovery of stalled replication forks.", "journal": "Molecular and cellular biology", "date": "2006-11", "authors": "Herzberg Kristina, Bashkirov Vladimir I, Rolfsmeier Michael, Haghnazari Edwin, McDonald W Hayes, Anderson Scott, Bashkirova Elena V, Yates John R, Heyer Wolf-Dietrich", "evidence": [ { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" } ], "reference": [ { "type": "PubMed", "id": "16966380", "url": "https://glygen.org/publication/PubMed/16966380" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "A truncated DNA-damage-signaling response is activated after DSB formation in the G1 phase of Saccharomyces cerevisiae.", "journal": "Nucleic acids research", "date": "2010-04", "authors": "Janke Ryan, Herzberg Kristina, Rolfsmeier Michael, Mar Jordan, Bashkirov Vladimir I, Haghnazari Edwin, Cantin Greg, Yates John R, Heyer Wolf-Dietrich", "evidence": [ { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" } ], "reference": [ { "type": "PubMed", "id": "20061370", "url": "https://glygen.org/publication/PubMed/20061370" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P38953", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38953" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Analysis of a 32.8 kb segment of yeast chromosome IV reveals 21 open reading frames, including TPS2, PPH3, RAD55, SED1, PDC2, AFR1, SSS1, SLU7 and a tRNA for arginine.", "journal": "Yeast", "date": "1995", "authors": "Goffeau A., Jonniaux J.-L., Coster F.", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "reference": [ { "type": "PubMed", "id": "7483840", "url": "https://glygen.org/publication/PubMed/7483840" } ] }, { "title": "Sequence of the RAD55 gene of Saccharomyces cerevisiae: similarity of RAD55 to prokaryotic RecA and other RecA-like proteins.", "journal": "Gene", "date": "1994", "authors": "Lovett S.T.", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "reference": [ { "type": "PubMed", "id": "8181742", "url": "https://glygen.org/publication/PubMed/8181742" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] } ], "pathway": [ { "id": "sce:YDR076W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR076W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "meiotic DNA recombinase assembly", "id": "GO:0000707", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000707", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "double-strand break repair", "id": "GO:0006302", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006302", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "reciprocal meiotic recombination", "id": "GO:0007131", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007131", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "DNA recombinase assembly", "id": "GO:0000730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000730", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "error-free postreplication DNA repair", "id": "GO:0042275", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042275", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "heteroduplex formation", "id": "GO:0030491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030491", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "positive regulation of single-strand break repair via homologous recombination", "id": "GO:1903112", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903112", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "Rad51C-XRCC3 complex", "id": "GO:0033065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033065", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "replication fork", "id": "GO:0005657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005657", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "Rad51B-Rad51C-Rad51D-XRCC2 complex", "id": "GO:0033063", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033063", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "ATP-dependent activity, acting on DNA", "id": "GO:0008094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008094", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" }, { "name": "ATP-dependent DNA damage sensor activity", "id": "GO:0140664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140664", "evidence": [ { "database": "UniProtKB", "id": "P38953", "url": "https://www.uniprot.org/uniprot/P38953" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }