{ "uniprot_canonical_ac": "P38876-1", "uniprot_ac": "P38876", "uniprot_id": "PTH_YEAST", "mass": { "chemical_mass": 21036.0, "monoisotopic_mass": 21036.0 }, "refseq": { "ac": "NP_012059", "name": "aminoacyl-tRNA hydrolase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012059" }, "gene_names": [ { "name": "PTH1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P38876", "id": "P38876" }, { "name": "PTH1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012059", "id": "NP_012059" } ], "protein_names": [ { "name": "Peptidyl-tRNA hydrolase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P38876" }, { "name": "3.1.1.29", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P38876" }, { "name": "PTH", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P38876" }, { "name": "aminoacyl-tRNA hydrolase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012059", "id": "NP_012059" } ], "function": [ { "annotation": "Peptidyl-tRNA hydrolase involved in the recycling of tRNA-Lys from diacetyl-lysyl-tRNA-Lys and is important for mitochondrial function.", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876#function" }, { "database": "PubMed", "id": "12799450", "url": "https://glygen.org/publication/PubMed/12799450" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "common_name": "Yeast" } ], "gene": [ { "name": "PTH1", "url": "https://www.uniprot.org/uniprot/P38876", "locus": {} } ], "crossref": [ { "id": "cd00462", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00462", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "856596", "url": "https://www.ncbi.nlm.nih.gov/gene/856596", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P38876", "url": "https://www.ebi.ac.uk/intact/interactors/id:P38876*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001328", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001328", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018171", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018171", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036416", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036416", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YHR189W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YHR189W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TECGALT", "url": "https://omabrowser.org/oma/group/TECGALT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1429686at2759", "url": "http://www.orthodb.org/?query=1429686at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR17224", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17224", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR17224:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17224:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01195", "url": "http://pfam.xfam.org/family/PF01195", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P38876", "url": "http://purl.obolibrary.org/obo/PR_P38876", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012059", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012059", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001232", "url": "https://www.yeastgenome.org/locus/S000001232", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P38876-1", "url": "https://www.uniprot.org/uniprot/P38876-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSGKWRLVLTGIGNPEPQYAGTRHNVGLYMLELLRKRLGLQGRTYSPVPNTGGKVHYIEDEHCTILRSDGQYMNLSGEQVCKVWARYAKYQARHVVIHDELSVACGKVQLRAPSTSIRGHNGLRSLLKCSGGRVPFAKLAIGIGREPGSRSRDPASVSRWVLGALTPQELQTLLTQSEPAAWRALTQYIS", "length": 190, "header": "sp|P38876-1|PTH_YEAST Isoform 1 of Peptidyl-tRNA hydrolase OS=Saccharomyces cerevisiae S288C OX=559292 GN=PTH1 PE=1 SV=1 CANONICAL=P38876-1" }, "isoforms": [ { "isoform_ac": "P38876-1", "url": "", "sequence": { "sequence": "MSGKWRLVLTGIGNPEPQYAGTRHNVGLYMLELLRKRLGLQGRTYSPVPNTGGKVHYIEDEHCTILRSDGQYMNLSGEQVCKVWARYAKYQARHVVIHDELSVACGKVQLRAPSTSIRGHNGLRSLLKCSGGRVPFAKLAIGIGREPGSRSRDPASVSRWVLGALTPQELQTLLTQSEPAAWRALTQYIS", "length": 190, "header": "sp|P38876-1|PTH_YEAST Isoform 1 of Peptidyl-tRNA hydrolase OS=Saccharomyces cerevisiae S288C OX=559292 GN=PTH1 PE=1 SV=1 CANONICAL=P38876-1" }, "locus": { "chromosome": "VIII", "start_pos": 484597, "end_pos": 484028, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YHR189W_mRNA", "url": "https://www.ensembl.org/id/YHR189W_mRNA" }, { "database": "Ensembl Peptide", "id": "YHR189W", "url": "https://www.ensembl.org/id/YHR189W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Orthologs of a novel archaeal and of the bacterial peptidyl-tRNA hydrolase are nonessential in yeast.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2002", "authors": "Wei D., Rinehart J., Soell D., Graham D.E., Ambrogelly A., Cruz-Vera L.R., Guarneros G., Rosas-Sandoval G., Stetter K.O.", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "reference": [ { "type": "PubMed", "id": "12475929", "url": "https://glygen.org/publication/PubMed/12475929" } ] }, { "title": "Peptidyl-tRNA hydrolase from Sulfolobus solfataricus.", "journal": "Nucleic Acids Res.", "date": "2003", "authors": "Blanquet S., Ferri-Fioni M.-L., Fromant M., Plateau P.", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "reference": [ { "type": "PubMed", "id": "12799450", "url": "https://glygen.org/publication/PubMed/12799450" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII.", "journal": "Science", "date": "1994", "authors": "Andrews S., Du Z., Fulton L., Hillier L.W., Latreille P., Mardis E., Vaudin M., Waterston R., Wilson R., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Ding H., Cooper J., Vaughan K., Macri C., Louis E.J., Johnston L., Nhan M., Menezes S., Johnston M., Dover J., Wilcox L., Brinkman R., Gattung S., Geisel C., Jier M., Kirsten J., Langston Y., Mouser L., Riles L., St Peter H., Vignati D.", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "reference": [ { "type": "PubMed", "id": "8091229", "url": "https://glygen.org/publication/PubMed/8091229" } ] }, { "title": "New protein functions in yeast chromosome VIII.", "journal": "Protein Sci.", "date": "1995", "authors": "Bork P., Casari G., Sander C., Ouzounis C.", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "reference": [ { "type": "PubMed", "id": "8563640", "url": "https://glygen.org/publication/PubMed/8563640" } ] } ], "pathway": [ { "id": "sce:YHR189W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YHR189W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "aminoacyl-tRNA hydrolase activity", "id": "GO:0004045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004045", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "mitochondrial translation", "id": "GO:0032543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032543", "evidence": [ { "database": "UniProtKB", "id": "P38876", "url": "https://www.uniprot.org/uniprot/P38876" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 74, "end_pos": 76, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "54448", "name": "", "equation": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5XI86-1", "D3ZBG6-1", "Q86Y79-1", "Q14197-1", "Q6GMV3-1", "Q9Y3E5-1", "D3Z4S3-1", "Q8R035-1", "Q8R2Y8-1", "Q8BW00-1", "P34222-1", "P38876-1", "Q54ZD0-1", "O97067-1", "Q9VG06-1", "Q9VET3-1" ], "evidence": [ { "id": "54448", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/54448" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "D3Z4S3", "gene_name": "Ptrhd1", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "D3Z4S3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z4S3" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "D3Z4S3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z4S3" } ] } ] }, { "uniprot_ac": "D3ZBG6", "gene_name": "Ptrhd1", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "D3ZBG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBG6" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "D3ZBG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBG6" } ] } ] }, { "uniprot_ac": "O97067", "gene_name": "", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "O97067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O97067" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "O97067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O97067" } ] } ] }, { "uniprot_ac": "P34222", "gene_name": "PTH2", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "P34222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34222" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "P34222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34222" } ] } ] }, { "uniprot_ac": "P38876", "gene_name": "PTH1", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "P38876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38876" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "P38876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38876" } ] } ] }, { "uniprot_ac": "Q14197", "gene_name": "MRPL58", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q14197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14197" } ] } ] }, { "uniprot_ac": "Q54ZD0", "gene_name": "pth2", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q54ZD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ZD0" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "Q54ZD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ZD0" } ] } ] }, { "uniprot_ac": "Q5XI86", "gene_name": "Ptrh2", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q5XI86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI86" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "Q5XI86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI86" } ] } ] }, { "uniprot_ac": "Q6GMV3", "gene_name": "PTRHD1", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q6GMV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6GMV3" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "Q6GMV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6GMV3" } ] } ] }, { "uniprot_ac": "Q86Y79", "gene_name": "PTRH1", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q86Y79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86Y79" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "Q86Y79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86Y79" } ] } ] }, { "uniprot_ac": "Q8BW00", "gene_name": "Ptrh1", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q8BW00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BW00" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "Q8BW00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BW00" } ] } ] }, { "uniprot_ac": "Q8R035", "gene_name": "Mrpl58", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q8R035", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R035" } ] } ] }, { "uniprot_ac": "Q8R2Y8", "gene_name": "Ptrh2", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q8R2Y8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2Y8" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "Q8R2Y8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2Y8" } ] } ] }, { "uniprot_ac": "Q9VET3", "gene_name": "Dmel\\CG14903", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q9VET3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VET3" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "Q9VET3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VET3" } ] } ] }, { "uniprot_ac": "Q9VG06", "gene_name": "Dmel\\CG17327", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q9VG06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG06" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "Q9VG06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG06" } ] } ] }, { "uniprot_ac": "Q9Y3E5", "gene_name": "PTRH2", "activity": [ { "ec_number": "3.1.1.29", "activity": "an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H(+).", "evidence": [ { "id": "Q9Y3E5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3E5" } ] }, { "ec_number": "3.1.1.29", "activity": "", "evidence": [ { "id": "Q9Y3E5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3E5" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }