{
    "uniprot_canonical_ac": "P38820-1",
    "uniprot_ac": "P38820",
    "uniprot_id": "UBA4_YEAST",
    "mass": {
        "chemical_mass": 49361.0,
        "monoisotopic_mass": 49361.0
    },
    "refseq": {
        "ac": "NP_011979",
        "name": "Uba4p",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011979"
    },
    "gene_names": [
        {
            "name": "UBA4",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P38820",
            "id": "P38820"
        },
        {
            "name": "NCS3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P38820",
            "id": "P38820"
        },
        {
            "name": "UBA4",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011979",
            "id": "NP_011979"
        },
        {
            "name": "YHR1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011979",
            "id": "NP_011979"
        }
    ],
    "protein_names": [
        {
            "name": "Adenylyltransferase and sulfurtransferase UBA4",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P38820"
        },
        {
            "name": "Needs CLA4 to survive protein 3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P38820"
        },
        {
            "name": "Uba4p",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011979",
            "id": "NP_011979"
        },
        {
            "name": "Ubiquitin-like protein activator 4",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P38820"
        }
    ],
    "function": [
        {
            "annotation": "Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Acts by mediating the C-terminal thiocarboxylation of sulfur carrier URM1. Its N-terminus first activates URM1 as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 to form thiocarboxylation (-COSH) of its C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. May also be involved in protein urmylation.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820#function"
                },
                {
                    "database": "PubMed",
                    "id": "18755837",
                    "url": "https://glygen.org/publication/PubMed/18755837"
                },
                {
                    "database": "PubMed",
                    "id": "18664566",
                    "url": "https://glygen.org/publication/PubMed/18664566"
                },
                {
                    "database": "PubMed",
                    "id": "19151091",
                    "url": "https://glygen.org/publication/PubMed/19151091"
                },
                {
                    "database": "PubMed",
                    "id": "18491921",
                    "url": "https://glygen.org/publication/PubMed/18491921"
                },
                {
                    "database": "PubMed",
                    "id": "10713047",
                    "url": "https://glygen.org/publication/PubMed/10713047"
                },
                {
                    "database": "PubMed",
                    "id": "19145231",
                    "url": "https://glygen.org/publication/PubMed/19145231"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [
        {
            "start_pos": 225,
            "end_pos": 225,
            "sequence_org": "C",
            "sequence_mut": "A",
            "comment": "Abolishes adenylyltransferase activity but not sulfurtransferase activity.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                },
                {
                    "database": "PubMed",
                    "id": "19151091",
                    "url": "https://glygen.org/publication/PubMed/19151091"
                },
                {
                    "database": "PubMed",
                    "id": "18491921",
                    "url": "https://glygen.org/publication/PubMed/18491921"
                },
                {
                    "database": "PubMed",
                    "id": "10713047",
                    "url": "https://glygen.org/publication/PubMed/10713047"
                },
                {
                    "database": "PubMed",
                    "id": "19145231",
                    "url": "https://glygen.org/publication/PubMed/19145231"
                }
            ]
        },
        {
            "start_pos": 225,
            "end_pos": 225,
            "sequence_org": "C",
            "sequence_mut": "S",
            "comment": "Abolishes adenylyltransferase activity but not sulfurtransferase activity.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                },
                {
                    "database": "PubMed",
                    "id": "19151091",
                    "url": "https://glygen.org/publication/PubMed/19151091"
                },
                {
                    "database": "PubMed",
                    "id": "18491921",
                    "url": "https://glygen.org/publication/PubMed/18491921"
                },
                {
                    "database": "PubMed",
                    "id": "10713047",
                    "url": "https://glygen.org/publication/PubMed/10713047"
                },
                {
                    "database": "PubMed",
                    "id": "19145231",
                    "url": "https://glygen.org/publication/PubMed/19145231"
                }
            ]
        },
        {
            "start_pos": 397,
            "end_pos": 397,
            "sequence_org": "C",
            "sequence_mut": "A",
            "comment": "Abolishes sulfurtransferase activity but not adenylyltransferase activity.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                },
                {
                    "database": "PubMed",
                    "id": "19151091",
                    "url": "https://glygen.org/publication/PubMed/19151091"
                },
                {
                    "database": "PubMed",
                    "id": "18491921",
                    "url": "https://glygen.org/publication/PubMed/18491921"
                },
                {
                    "database": "PubMed",
                    "id": "19145231",
                    "url": "https://glygen.org/publication/PubMed/19145231"
                }
            ]
        },
        {
            "start_pos": 397,
            "end_pos": 397,
            "sequence_org": "C",
            "sequence_mut": "S",
            "comment": "Abolishes sulfurtransferase activity but not adenylyltransferase activity.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                },
                {
                    "database": "PubMed",
                    "id": "19151091",
                    "url": "https://glygen.org/publication/PubMed/19151091"
                },
                {
                    "database": "PubMed",
                    "id": "18491921",
                    "url": "https://glygen.org/publication/PubMed/18491921"
                },
                {
                    "database": "PubMed",
                    "id": "19145231",
                    "url": "https://glygen.org/publication/PubMed/19145231"
                }
            ]
        }
    ],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "UBA4",
            "url": "https://www.uniprot.org/uniprot/P38820",
            "locus": {
                "chromosome": "VIII",
                "start_pos": 334394,
                "end_pos": 333072,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "YHR111W",
                        "url": "https://www.ensembl.org/id/YHR111W"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "2.7.7.B4",
            "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.7.B4&UniProtAcc=P38820",
            "database": "BRENDA",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "2.8.1.B2",
            "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.8.1.B2&UniProtAcc=P38820",
            "database": "BRENDA",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "cd00757",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00757",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd01526",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01526",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "856511",
            "url": "https://www.ncbi.nlm.nih.gov/gene/856511",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "P38820",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P38820*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR000594",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000594",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001763",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001763",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR028885",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR028885",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR035985",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR035985",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036873",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036873",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR045886",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR045886",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YHR111W",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YHR111W",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "MIYDALE",
            "url": "https://omabrowser.org/oma/group/MIYDALE/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "53913at2759",
            "url": "http://www.orthodb.org/?query=53913at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10953",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10953",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10953:SF102",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10953:SF102",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00581",
            "url": "http://pfam.xfam.org/family/PF00581",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00899",
            "url": "http://pfam.xfam.org/family/PF00899",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P38820",
            "url": "http://purl.obolibrary.org/obo/PR_P38820",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_011979",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011979",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000001153",
            "url": "https://www.yeastgenome.org/locus/S000001153",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P38820",
            "url": "https://www.uniprot.org/uniprot/P38820",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P38820-1",
            "url": "https://www.uniprot.org/uniprot/P38820-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MNDYHLEDTTSELEALRLENAQLREQLAKREDSSRDYPLSLEEYQRYGRQMIVEETGGVAGQVKLKNTKVLVVGAGGLGCPALPYLAGAGVGQIGIVDNDVVETSNLHRQVLHDSSRVGMLKCESARQYITKLNPHINVVTYPVRLNSSNAFDIFKGYNYILDCTDSPLTRYLVSDVAVNLGITVVSASGLGTEGQLTILNFNNIGPCYRCFYPTPPPPNAVTSCQEGGVIGPCIGLVGTMMAVETLKLILGIYTNENFSPFLMLYSGFPQQSLRTFKMRGRQEKCLCCGKNRTITKEAIEKGEINYELFCGARNYNVCEPDERISVDAFQRIYKDDEFLAKHIFLDVRPSHHYEISHFPEAVNIPIKNLRDMNGDLKKLQEKLPSVEKDSNIVILCRYGNDSQLATRLLKDKFGFSNVRDVRGGYFKYIDDIDQTIPKY",
        "length": 440,
        "header": "sp|P38820-1|UBA4_YEAST Isoform 1 of Adenylyltransferase and sulfurtransferase UBA4  OS=Saccharomyces cerevisiae S288C OX=559292 GN=UBA4 PE=1 SV=1 CANONICAL=P38820-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P38820-1",
            "url": "",
            "sequence": {
                "sequence": "MNDYHLEDTTSELEALRLENAQLREQLAKREDSSRDYPLSLEEYQRYGRQMIVEETGGVAGQVKLKNTKVLVVGAGGLGCPALPYLAGAGVGQIGIVDNDVVETSNLHRQVLHDSSRVGMLKCESARQYITKLNPHINVVTYPVRLNSSNAFDIFKGYNYILDCTDSPLTRYLVSDVAVNLGITVVSASGLGTEGQLTILNFNNIGPCYRCFYPTPPPPNAVTSCQEGGVIGPCIGLVGTMMAVETLKLILGIYTNENFSPFLMLYSGFPQQSLRTFKMRGRQEKCLCCGKNRTITKEAIEKGEINYELFCGARNYNVCEPDERISVDAFQRIYKDDEFLAKHIFLDVRPSHHYEISHFPEAVNIPIKNLRDMNGDLKKLQEKLPSVEKDSNIVILCRYGNDSQLATRLLKDKFGFSNVRDVRGGYFKYIDDIDQTIPKY",
                "length": 440,
                "header": "sp|P38820-1|UBA4_YEAST Isoform 1 of Adenylyltransferase and sulfurtransferase UBA4  OS=Saccharomyces cerevisiae S288C OX=559292 GN=UBA4 PE=1 SV=1 CANONICAL=P38820-1"
            },
            "locus": {
                "chromosome": "VIII",
                "start_pos": 334391,
                "end_pos": 333072,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YHR111W_mRNA",
                        "url": "https://www.ensembl.org/id/YHR111W_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YHR111W",
                        "url": "https://www.ensembl.org/id/YHR111W"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 326,
            "end_pos": 326,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "SGD",
                    "id": "P38820",
                    "url": "https://www.yeastgenome.org/locus/P38820"
                },
                {
                    "database": "iPTMnet",
                    "id": "P38820",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38820"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Ser326"
        }
    ],
    "glycation": [],
    "keywords": [
        "enzyme"
    ],
    "publication": [
        {
            "title": "A protein conjugation system in yeast with homology to biosynthetic enzyme reaction of prokaryotes.",
            "journal": "J. Biol. Chem.",
            "date": "2000",
            "authors": "Furukawa K, Mizushima N, Noda T, Ohsumi Y",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10713047",
                    "url": "https://glygen.org/publication/PubMed/10713047"
                }
            ]
        },
        {
            "title": "Global analysis of protein localization in budding yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562095",
                    "url": "https://glygen.org/publication/PubMed/14562095"
                }
            ]
        },
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2008-07",
            "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                },
                {
                    "database": "iPTMnet",
                    "id": "P38820",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                }
            ]
        },
        {
            "title": "The sulfurtransferase activity of Uba4 presents a link between ubiquitin-like protein conjugation and activation of sulfur carrier proteins.",
            "journal": "Biochemistry",
            "date": "2008",
            "authors": "Schmitz J, Chowdhury MM, Hanzelmann P, Nimtz M, Lee EY, Schindelin H, Leimkuhler S",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18491921",
                    "url": "https://glygen.org/publication/PubMed/18491921"
                }
            ]
        },
        {
            "title": "Thio-modification of yeast cytosolic tRNA requires a ubiquitin-related system that resembles bacterial sulfur transfer systems.",
            "journal": "J. Biol. Chem.",
            "date": "2008",
            "authors": "Hayashi H., Nakai Y., Nakai M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18664566",
                    "url": "https://glygen.org/publication/PubMed/18664566"
                }
            ]
        },
        {
            "title": "A genome-wide screen identifies genes required for formation of the wobble nucleoside 5-methoxycarbonylmethyl-2-thiouridine in Saccharomyces cerevisiae.",
            "journal": "RNA",
            "date": "2008",
            "authors": "Lu J., Huang B., Bystroem A.S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18755837",
                    "url": "https://glygen.org/publication/PubMed/18755837"
                }
            ]
        },
        {
            "title": "Ubiquitin-related modifier Urm1 acts as a sulphur carrier in thiolation of eukaryotic transfer RNA.",
            "journal": "Nature",
            "date": "2009",
            "authors": "Leidel Sebastian, Pedrioli Patrick G A, Bucher Tamara, Brost Ren\u00e9e, Costanzo Michael, Schmidt Alexander, Aebersold Ruedi, Boone Charles, Hofmann Kay, Peter Matthias",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19145231",
                    "url": "https://glygen.org/publication/PubMed/19145231"
                }
            ]
        },
        {
            "title": "Mechanistic characterization of the sulfur-relay system for eukaryotic 2-thiouridine biogenesis at tRNA wobble positions.",
            "journal": "Nucleic Acids Res.",
            "date": "2009",
            "authors": "Noma Akiko, Sakaguchi Yuriko, Suzuki Tsutomu",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19151091",
                    "url": "https://glygen.org/publication/PubMed/19151091"
                }
            ]
        },
        {
            "title": "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2012",
            "authors": "Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22814378",
                    "url": "https://glygen.org/publication/PubMed/22814378"
                }
            ]
        },
        {
            "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.",
            "journal": "Nature methods",
            "date": "2013-07",
            "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P38820",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII.",
            "journal": "Science",
            "date": "1994",
            "authors": "Andrews S., Du Z., Fulton L., Hillier L.W., Latreille P., Mardis E., Vaudin M., Waterston R., Wilson R., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Ding H., Cooper J., Vaughan K., Macri C., Louis E.J., Johnston L., Nhan M., Menezes S., Johnston M., Dover J., Wilcox L., Brinkman R., Gattung S., Geisel C., Jier M., Kirsten J., Langston Y., Mouser L., Riles L., St Peter H., Vignati D.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P38820",
                    "url": "https://www.uniprot.org/uniprot/P38820"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8091229",
                    "url": "https://glygen.org/publication/PubMed/8091229"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YHR111W",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YHR111W",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "A2BDX3-1",
            "protein_name": "Adenylyltransferase and sulfurtransferase MOCS3",
            "gene_name": "Mocs3",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MAAPEDVAALQAEITRREEELASLKRRLAAALTAEPEPERPLRVPPPPLAPRAALSRDEILRYSRQLLLPELGVRGQLRLAAAAVLVVGCGGLGCPLAQYLAAAGVGRLGLVDHDVVETSNLARQVLHGEAQAGESKARSAAAALRRLNSAVECVAYPRALAEDWALDLVRGYDVVADCCDNVPTRYLVNDACVLAGRPLVSASALRFEGQMTVYHHDGGPCYRCVFPRPPPPETVTNCADGGVLGAVPGVLGCAQALEVLKIAAGLGSSYSGSMLLFDGLGGHFRRIRLRRRRPDCVVCGQQPTVTRLQDYEAFCGSSATDKCRALKLLCPEERISVTDYKRLLDSGAPHVLLDVRPQVEVDICRLPHSLHIPLSQLERRDADSLKLLGAALRKGKQESQEGVALPVYVICKLGNDSQKAVKVLQSLTAVPELDSLTVQDIVGGLMAWAAKIDGTFPQY",
                "length": 460
            },
            "evidence": [
                {
                    "id": "P38820",
                    "url": "https://omabrowser.org/oma/group/P38820/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "O95396-1",
            "protein_name": "Adenylyltransferase and sulfurtransferase MOCS3",
            "gene_name": "MOCS3",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY",
                "length": 460
            },
            "evidence": [
                {
                    "id": "P38820",
                    "url": "https://omabrowser.org/oma/group/P38820/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q9VLJ8-1",
            "protein_name": "Adenylyltransferase and sulfurtransferase MOCS3",
            "gene_name": "Uba4",
            "tax_id": 7227,
            "organism": "Drosophila melanogaster",
            "sequence": {
                "sequence": "MMESEVDSERTMLKREIAELRAALNQKEQCLRELDSLFSFATRPEQEVVGNDLESPDVAVHTKLTNDDIARYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPHCEIQCHSRMLYPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVMLSKPLVSGSALKMDGQLTVYNYANGPCYRCIFPVPPPPEAVTNCGDGGVLGAVTGTIGAMQALEAIKVIVGMGDVLAGRLLIFDGGSGVFRNIRIRSKRPNCHMCSAQPLITELINYEMFCGMHATDKNNPMLLLSTDERLSVEDYQQKIQAQPHLLIDVRPTAEFEICQLPEAVNVPLVEILDDSYLKRLGKQLEDKELPIVLVCRRGNDSQIAVQHLRNRFPTHFVRDLIGGLHAWTNSVDPSFPIY",
                "length": 453
            },
            "evidence": [
                {
                    "id": "P38820",
                    "url": "https://omabrowser.org/oma/group/P38820/",
                    "database": "OMA"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 8,
                "go_terms": [
                    {
                        "name": "tRNA wobble position uridine thiolation",
                        "id": "GO:0002143",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002143",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "tRNA thio-modification",
                        "id": "GO:0034227",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034227",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cellular response to oxidative stress",
                        "id": "GO:0034599",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034599",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "tRNA wobble uridine modification",
                        "id": "GO:0002098",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002098",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein urmylation",
                        "id": "GO:0032447",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032447",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "invasive growth in response to glucose limitation",
                        "id": "GO:0001403",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001403",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell budding",
                        "id": "GO:0007114",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007114",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of pseudohyphal growth",
                        "id": "GO:2000220",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000220",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 8,
                "go_terms": [
                    {
                        "name": "sulfurtransferase activity",
                        "id": "GO:0016783",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016783",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ATP binding",
                        "id": "GO:0005524",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "identical protein binding",
                        "id": "GO:0042802",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "metal ion binding",
                        "id": "GO:0046872",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nucleotidyltransferase activity",
                        "id": "GO:0016779",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016779",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein adenylyltransferase activity",
                        "id": "GO:0070733",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070733",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "thiosulfate sulfurtransferase activity",
                        "id": "GO:0004792",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004792",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "URM1 activating enzyme activity",
                        "id": "GO:0042292",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042292",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytosol",
                        "id": "GO:0005829",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P38820",
                                "url": "https://www.uniprot.org/uniprot/P38820"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 147,
            "end_pos": 149,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 258,
            "end_pos": 260,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 292,
            "end_pos": 294,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 401,
            "end_pos": 403,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 13
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}