{ "uniprot_canonical_ac": "P38760-1", "uniprot_ac": "P38760", "uniprot_id": "MIP6_YEAST", "mass": { "chemical_mass": 75920.0, "monoisotopic_mass": 75920.0 }, "refseq": { "ac": "NP_011879", "name": "Mip6p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011879" }, "gene_names": [ { "name": "MIP6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P38760", "id": "P38760" }, { "name": "MIP6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011879", "id": "NP_011879" } ], "protein_names": [ { "name": "RNA-binding protein MIP6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P38760" }, { "name": "MEX67-interacting protein 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P38760" }, { "name": "Mip6p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011879", "id": "NP_011879" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "common_name": "Yeast" } ], "gene": [ { "name": "MIP6", "url": "https://www.uniprot.org/uniprot/P38760", "locus": {} } ], "crossref": [ { "id": "cd21601", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21601", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd21602", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21602", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd21603", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21603", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd21604", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21604", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "856408", "url": "https://www.ncbi.nlm.nih.gov/gene/856408", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P38760", "url": "https://www.ebi.ac.uk/intact/interactors/id:P38760*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YHR015W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YHR015W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IICGLHF", "url": "https://omabrowser.org/oma/group/IICGLHF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1973174at2759", "url": "http://www.orthodb.org/?query=1973174at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48025", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48025", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48025:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48025:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5D77", "url": "https://www.rcsb.org/structure/5D77", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5D78", "url": "https://www.rcsb.org/structure/5D78", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P38760", "url": "http://purl.obolibrary.org/obo/PR_P38760", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_011879", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011879", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001057", "url": "https://www.yeastgenome.org/locus/S000001057", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P38760-1", "url": "https://www.uniprot.org/uniprot/P38760-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPNSHGNVLNNISLNSKQNPRSISKSCPNDKDARQKSFKTISAQALVRVQGAGYKLGDVKLKDAEVKEKNSLKKYDCKNATQEKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSCLLERRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKRKKMIGSDIVIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTPHKAFVTYKNEEESKKAQKCLNKTIFKNHTIWVGPGKDKPVHNQIGTNKKTKVYLKNLSFNCNKEFISQLCLQEKIRFSEIKITNYNSLNWTFCGHVECFSRSDAERLFNILDRRLIGSSLVEASWSKNNDNILNEIDYDDGNNNENYKKLINISSMMRFRTQELSAHQKGLTSQFQQVVSPFSSYSNSYTNMNSLVATPMKPHPAFNLITNTVDEKLHQPKRTKQENAEILESLKKIINRNLQRISISGLNKEENLRSISEFIFDVFWEHDSERLSHFLLMTNTSLESQKILQKQVTRAAESLGFTV", "length": 659, "header": "sp|P38760-1|MIP6_YEAST Isoform 1 of RNA-binding protein MIP6 OS=Saccharomyces cerevisiae S288C OX=559292 GN=MIP6 PE=1 SV=1 CANONICAL=P38760-1" }, "isoforms": [ { "isoform_ac": "P38760-1", "url": "", "sequence": { "sequence": "MPNSHGNVLNNISLNSKQNPRSISKSCPNDKDARQKSFKTISAQALVRVQGAGYKLGDVKLKDAEVKEKNSLKKYDCKNATQEKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSCLLERRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKRKKMIGSDIVIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTPHKAFVTYKNEEESKKAQKCLNKTIFKNHTIWVGPGKDKPVHNQIGTNKKTKVYLKNLSFNCNKEFISQLCLQEKIRFSEIKITNYNSLNWTFCGHVECFSRSDAERLFNILDRRLIGSSLVEASWSKNNDNILNEIDYDDGNNNENYKKLINISSMMRFRTQELSAHQKGLTSQFQQVVSPFSSYSNSYTNMNSLVATPMKPHPAFNLITNTVDEKLHQPKRTKQENAEILESLKKIINRNLQRISISGLNKEENLRSISEFIFDVFWEHDSERLSHFLLMTNTSLESQKILQKQVTRAAESLGFTV", "length": 659, "header": "sp|P38760-1|MIP6_YEAST Isoform 1 of RNA-binding protein MIP6 OS=Saccharomyces cerevisiae S288C OX=559292 GN=MIP6 PE=1 SV=1 CANONICAL=P38760-1" }, "locus": { "chromosome": "VIII", "start_pos": 136530, "end_pos": 134554, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YHR015W_mRNA", "url": "https://www.ensembl.org/id/YHR015W_mRNA" }, { "database": "Ensembl Peptide", "id": "YHR015W", "url": "https://www.ensembl.org/id/YHR015W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII.", "journal": "Science", "date": "1994", "authors": "Andrews S., Du Z., Fulton L., Hillier L.W., Latreille P., Mardis E., Vaudin M., Waterston R., Wilson R., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Ding H., Cooper J., Vaughan K., Macri C., Louis E.J., Johnston L., Nhan M., Menezes S., Johnston M., Dover J., Wilcox L., Brinkman R., Gattung S., Geisel C., Jier M., Kirsten J., Langston Y., Mouser L., Riles L., St Peter H., Vignati D.", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "reference": [ { "type": "PubMed", "id": "8091229", "url": "https://glygen.org/publication/PubMed/8091229" } ] }, { "title": "Mex67p, a novel factor for nuclear mRNA export, binds to both poly(A)+ RNA and nuclear pores.", "journal": "EMBO J.", "date": "1997", "authors": "Luehrmann R., Hurt E., Sharma K., Huber J., Segref A., Doye V., Hellwig A.", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "reference": [ { "type": "PubMed", "id": "9214641", "url": "https://glygen.org/publication/PubMed/9214641" } ] } ], "pathway": [ { "id": "sce:YHR015W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YHR015W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "mRNA metabolic process", "id": "GO:0016071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016071", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" }, { "name": "mRNA localization resulting in post-transcriptional regulation of gene expression", "id": "GO:0010609", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010609", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" }, { "name": "regulation of translation", "id": "GO:0006417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006417", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" }, { "name": "mRNA 3'-UTR binding", "id": "GO:0003730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003730", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" }, { "name": "poly(A) binding", "id": "GO:0008143", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008143", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" }, { "name": "poly(U) RNA binding", "id": "GO:0008266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008266", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" }, { "name": "cytoplasmic stress granule", "id": "GO:0010494", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010494", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" }, { "name": "prospore membrane", "id": "GO:0005628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005628", "evidence": [ { "database": "UniProtKB", "id": "P38760", "url": "https://www.uniprot.org/uniprot/P38760" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 11, "end_pos": 13, "annotation": "n_glycosylation_sequon" }, { "start_pos": 173, "end_pos": 175, "annotation": "n_glycosylation_sequon" }, { "start_pos": 305, "end_pos": 307, "annotation": "n_glycosylation_sequon" }, { "start_pos": 373, "end_pos": 375, "annotation": "n_glycosylation_sequon" }, { "start_pos": 379, "end_pos": 381, "annotation": "n_glycosylation_sequon" }, { "start_pos": 408, "end_pos": 410, "annotation": "n_glycosylation_sequon" }, { "start_pos": 441, "end_pos": 443, "annotation": "n_glycosylation_sequon" }, { "start_pos": 504, "end_pos": 506, "annotation": "n_glycosylation_sequon" }, { "start_pos": 635, "end_pos": 637, "annotation": "n_glycosylation_sequon" }, { "start_pos": 79, "end_pos": 81, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }