{ "uniprot_canonical_ac": "P38720-1", "uniprot_ac": "P38720", "uniprot_id": "6PGD1_YEAST", "mass": { "chemical_mass": 53543.0, "monoisotopic_mass": 53543.0 }, "refseq": { "ac": "NP_012053", "name": "phosphogluconate dehydrogenase (decarboxylating) GND1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012053" }, "gene_names": [ { "name": "GND1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P38720", "id": "P38720" }, { "name": "GND1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012053", "id": "NP_012053" } ], "protein_names": [ { "name": "6-phosphogluconate dehydrogenase, decarboxylating 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P38720" }, { "name": "1.1.1.44", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P38720" }, { "name": "phosphogluconate dehydrogenase (decarboxylating) GND1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012053", "id": "NP_012053" } ], "function": [ { "annotation": "Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH.", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720#function" }, { "database": "PubMed", "id": "17570834", "url": "https://glygen.org/publication/PubMed/17570834" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "common_name": "Yeast" } ], "gene": [ { "name": "GND1", "url": "https://www.uniprot.org/uniprot/P38720", "locus": {} } ], "crossref": [ { "id": "1.1.1.44", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.44&UniProtAcc=P38720", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "856589", "url": "https://www.ncbi.nlm.nih.gov/gene/856589", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P38720", "url": "https://www.ebi.ac.uk/intact/interactors/id:P38720*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006113", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006113", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006114", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006114", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006115", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006115", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006183", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006183", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006184", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006184", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008927", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008927", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013328", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013328", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YHR183W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YHR183W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FRTWNTG", "url": "https://omabrowser.org/oma/group/FRTWNTG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3013545at2759", "url": "http://www.orthodb.org/?query=3013545at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11811", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11811", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11811:SF25", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11811:SF25", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2P4Q", "url": "https://www.rcsb.org/structure/2P4Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00393", "url": "http://pfam.xfam.org/family/PF00393", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03446", "url": "http://pfam.xfam.org/family/PF03446", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P38720", "url": "http://purl.obolibrary.org/obo/PR_P38720", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012053", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001226", "url": "https://www.yeastgenome.org/locus/S000001226", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P38720-1", "url": "https://www.uniprot.org/uniprot/P38720-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSADFGLIGLAVMGQNLILNAADHGFTVCAYNRTQSKVDHFLANEAKGKSIIGATSIEDFISKLKRPRKVMLLVKAGAPVDALINQIVPLLEKGDIIIDGGNSHFPDSNRRYEELKKKGILFVGSGVSGGEEGARYGPSLMPGGSEEAWPHIKNIFQSISAKSDGEPCCEWVGPAGAGHYVKMVHNGIEYGDMQLICEAYDIMKRLGGFTDKEISDVFAKWNNGVLDSFLVEITRDILKFDDVDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSALKNERIRASKVLPGPEVPKDAVKDREQFVDDLEQALYASKIISYAQGFMLIREAAATYGWKLNNPAIALMWRGGCIIRSVFLGQITKAYREEPDLENLLFNKFFADAVTKAQSGWRKSIALATTYGIPTPAFSTALSFYDGYRSERLPANLLQAQRDYFGAHTFRVLPECASDNLPVDKDIHINWTGHGGNVSSSTYQA", "length": 489, "header": "sp|P38720-1|6PGD1_YEAST Isoform 1 of 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=GND1 PE=1 SV=1 CANONICAL=P38720-1" }, "isoforms": [ { "isoform_ac": "P38720-1", "url": "", "sequence": { "sequence": "MSADFGLIGLAVMGQNLILNAADHGFTVCAYNRTQSKVDHFLANEAKGKSIIGATSIEDFISKLKRPRKVMLLVKAGAPVDALINQIVPLLEKGDIIIDGGNSHFPDSNRRYEELKKKGILFVGSGVSGGEEGARYGPSLMPGGSEEAWPHIKNIFQSISAKSDGEPCCEWVGPAGAGHYVKMVHNGIEYGDMQLICEAYDIMKRLGGFTDKEISDVFAKWNNGVLDSFLVEITRDILKFDDVDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSALKNERIRASKVLPGPEVPKDAVKDREQFVDDLEQALYASKIISYAQGFMLIREAAATYGWKLNNPAIALMWRGGCIIRSVFLGQITKAYREEPDLENLLFNKFFADAVTKAQSGWRKSIALATTYGIPTPAFSTALSFYDGYRSERLPANLLQAQRDYFGAHTFRVLPECASDNLPVDKDIHINWTGHGGNVSSSTYQA", "length": 489, "header": "sp|P38720-1|6PGD1_YEAST Isoform 1 of 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=GND1 PE=1 SV=1 CANONICAL=P38720-1" }, "locus": { "chromosome": "VIII", "start_pos": 472426, "end_pos": 470960, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YHR183W_mRNA", "url": "https://www.ensembl.org/id/YHR183W_mRNA" }, { "database": "Ensembl Peptide", "id": "YHR183W", "url": "https://www.ensembl.org/id/YHR183W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 128, "end_pos": 128, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P38720", "url": "https://www.yeastgenome.org/locus/P38720" }, { "database": "iPTMnet", "id": "P38720", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38720" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Ser128" }, { "start_pos": 158, "end_pos": 158, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38720", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38720" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P38720", "url": "https://www.yeastgenome.org/locus/P38720" } ], "site_lbl": "Ser158" }, { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38720", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38720" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P38720", "url": "https://www.yeastgenome.org/locus/P38720" } ], "site_lbl": "Ser160" }, { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P38720", "url": "https://www.yeastgenome.org/locus/P38720" }, { "database": "iPTMnet", "id": "P38720", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38720" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser289" }, { "start_pos": 50, "end_pos": 50, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P38720", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38720" } ], "site_lbl": "Ser50" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Crystal structure of Saccharomyces cerevisiae 6-phosphogluconate dehydrogenase Gnd1.", "journal": "BMC Struct. Biol.", "date": "2007", "authors": "Liu W., Wang Y., He W., Zhou C.Z.", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "reference": [ { "type": "PubMed", "id": "17570834", "url": "https://glygen.org/publication/PubMed/17570834" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P38720", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38720" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" }, { "database": "iPTMnet", "id": "P38720", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38720" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P38720", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38720" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Protein identifications for a Saccharomyces cerevisiae protein database.", "journal": "Electrophoresis", "date": "1994", "authors": "Kobayashi R., Futcher B., Garrels J.I., Latter G.I., McLaughlin C.S., Schwender B., Volpe T., Warner J.R.", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "reference": [ { "type": "PubMed", "id": "7895733", "url": "https://glygen.org/publication/PubMed/7895733" } ] }, { "title": "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII.", "journal": "Science", "date": "1994", "authors": "Andrews S., Du Z., Fulton L., Hillier L.W., Latreille P., Mardis E., Vaudin M., Waterston R., Wilson R., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Ding H., Cooper J., Vaughan K., Macri C., Louis E.J., Johnston L., Nhan M., Menezes S., Johnston M., Dover J., Wilcox L., Brinkman R., Gattung S., Geisel C., Jier M., Kirsten J., Langston Y., Mouser L., Riles L., St Peter H., Vignati D.", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "reference": [ { "type": "PubMed", "id": "8091229", "url": "https://glygen.org/publication/PubMed/8091229" } ] } ], "pathway": [ { "id": "sce:YHR183W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YHR183W", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P52209-1", "protein_name": "6-phosphogluconate dehydrogenase, decarboxylating", "gene_name": "PGD", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA", "length": 483 }, "evidence": [ { "id": "P38720", "url": "https://omabrowser.org/oma/group/P38720/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9DCD0-1", "protein_name": "6-phosphogluconate dehydrogenase, decarboxylating", "gene_name": "Pgd", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKDMVSKLKKPRRVILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKAIFQAIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMRHEEMAQAFEEWNKTELDSFLIEITANILKYRDTDGKELLPKIRDSAGQKGTGKWTAISALEYGMPVTLIGEAVFARCLSSLKEERVQASQKLKGPKVVQLEGSKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFERNPELQNLLLDDFFKSAVDNCQDSWRRVISTGVQAGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLTKPGEFIHTNWTGHGGSVSSSSYNA", "length": 483 }, "evidence": [ { "id": "P38720", "url": "https://omabrowser.org/oma/group/P38720/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "D-gluconate catabolic process", "id": "GO:0046177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046177", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "pmid": "" }, { "name": "pentose-phosphate shunt, oxidative branch", "id": "GO:0009051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009051", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "pmid": "" }, { "name": "cellular response to oxidative stress", "id": "GO:0034599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034599", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "phosphogluconate dehydrogenase (decarboxylating) activity", "id": "GO:0004616", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004616", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "pmid": "" }, { "name": "NADP binding", "id": "GO:0050661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050661", "evidence": [ { "database": "UniProtKB", "id": "P38720", "url": "https://www.uniprot.org/uniprot/P38720" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 32, "end_pos": 34, "annotation": "n_glycosylation_sequon" }, { "start_pos": 474, "end_pos": 476, "annotation": "n_glycosylation_sequon" }, { "start_pos": 481, "end_pos": 483, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10116", "name": "", "equation": "6-phospho-D-gluconate + NADP(+) = CO2 + D-ribulose 5-phosphate + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P85968-1", "O88658-1", "P52209-1", "Q9DCD0-1", "P38720-1", "P53319-1", "Q8TA03-1", "P41572-1" ], "evidence": [ { "id": "10116", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10116" } ] }, { "id": "R-SCE-71299", "name": "6-phospho-D-gluconate + NADP+ => D-ribulose 5-phosphate + CO2 + NADPH + H+", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-29732" ], "enzyme_list": [ "P38720-1" ], "evidence": [ { "id": "R-SCE-71299", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-71299" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-29732", "participant_name": "RU5P [cytosol]", "crossref": [ { "id": "C00199", "database": "COMPOUND", "url": "" }, { "id": "58121", "database": "ChEBI", "url": "" }, { "id": "000001532567", "database": "ZINC", "url": "" }, { "id": "C00199", "database": "COMPOUND", "url": "" }, { "id": "58121", "database": "ChEBI", "url": "" }, { "id": "000001532567", "database": "ZINC", "url": "" }, { "id": "C00199", "database": "COMPOUND", "url": "" }, { "id": "58121", "database": "ChEBI", "url": "" }, { "id": "000001532567", "database": "ZINC", "url": "" }, { "id": "C00199", "database": "COMPOUND", "url": "" }, { "id": "58121", "database": "ChEBI", "url": "" }, { "id": "000001532567", "database": "ZINC", "url": "" }, { "id": "58121", "database": "ChEBI", "url": "" }, { "id": "C00199", "database": "COMPOUND", "url": "" }, { "id": "000001532567", "database": "ZINC", "url": "" }, { "id": "C00199", "database": "COMPOUND", "url": "" }, { "id": "58121", "database": "ChEBI", "url": "" }, { "id": "000001532567", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O88658", "gene_name": "Kif1b", "activity": [ { "ec_number": "1.1.1.44", "activity": "6-phospho-D-gluconate + NADP(+) = CO2 + D-ribulose 5-phosphate + NADPH.", "evidence": [ { "id": "O88658", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88658" } ] }, { "ec_number": "1.1.1.44", "activity": "", "evidence": [ { "id": "O88658", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88658" } ] } ] }, { "uniprot_ac": "P38720", "gene_name": "GND1", "activity": [ { "ec_number": "1.1.1.44", "activity": "6-phospho-D-gluconate + NADP(+) = CO2 + D-ribulose 5-phosphate + NADPH.", "evidence": [ { "id": "P38720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38720" } ] }, { "ec_number": "1.1.1.44", "activity": "", "evidence": [ { "id": "P38720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38720" } ] } ] }, { "uniprot_ac": "P41572", "gene_name": "Pgd", "activity": [ { "ec_number": "1.1.1.44", "activity": "6-phospho-D-gluconate + NADP(+) = CO2 + D-ribulose 5-phosphate + NADPH.", "evidence": [ { "id": "P41572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41572" } ] }, { "ec_number": "1.1.1.44", "activity": "", "evidence": [ { "id": "P41572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41572" } ] } ] }, { "uniprot_ac": "P52209", "gene_name": "PGD", "activity": [ { "ec_number": "1.1.1.44", "activity": "6-phospho-D-gluconate + NADP(+) = CO2 + D-ribulose 5-phosphate + NADPH.", "evidence": [ { "id": "P52209", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52209" } ] }, { "ec_number": "1.1.1.44", "activity": "", "evidence": [ { "id": "P52209", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52209" } ] } ] }, { "uniprot_ac": "P53319", "gene_name": "GND2", "activity": [ { "ec_number": "1.1.1.44", "activity": "6-phospho-D-gluconate + NADP(+) = CO2 + D-ribulose 5-phosphate + NADPH.", "evidence": [ { "id": "P53319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53319" } ] }, { "ec_number": "1.1.1.44", "activity": "", "evidence": [ { "id": "P53319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53319" } ] } ] }, { "uniprot_ac": "P85968", "gene_name": "Pgd", "activity": [ { "ec_number": "1.1.1.44", "activity": "6-phospho-D-gluconate + NADP(+) = CO2 + D-ribulose 5-phosphate + NADPH.", "evidence": [ { "id": "P85968", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P85968" } ] }, { "ec_number": "1.1.1.44", "activity": "", "evidence": [ { "id": "P85968", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P85968" } ] } ] }, { "uniprot_ac": "Q8TA03", "gene_name": "gnd", "activity": [ { "ec_number": "1.1.1.44", "activity": "6-phospho-D-gluconate + NADP(+) = CO2 + D-ribulose 5-phosphate + NADPH.", "evidence": [ { "id": "Q8TA03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TA03" } ] }, { "ec_number": "1.1.1.44", "activity": "", "evidence": [ { "id": "Q8TA03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TA03" } ] } ] }, { "uniprot_ac": "Q9DCD0", "gene_name": "Pgd", "activity": [ { "ec_number": "1.1.1.44", "activity": "6-phospho-D-gluconate + NADP(+) = CO2 + D-ribulose 5-phosphate + NADPH.", "evidence": [ { "id": "Q9DCD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCD0" } ] }, { "ec_number": "1.1.1.44", "activity": "", "evidence": [ { "id": "Q9DCD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCD0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }