{ "uniprot_canonical_ac": "P38284-1", "uniprot_ac": "P38284", "uniprot_id": "ICS2_YEAST", "mass": { "chemical_mass": 28772.0, "monoisotopic_mass": 28772.0 }, "refseq": { "ac": "NP_009715", "name": "Ics2p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009715" }, "gene_names": [ { "name": "ICS2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P38284", "id": "P38284" }, { "name": "ICS2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009715", "id": "NP_009715" }, { "name": "YBR1207", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P38284", "id": "P38284" } ], "protein_names": [ { "name": "Increased copper sensitivity protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P38284" }, { "name": "Ics2p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009715", "id": "NP_009715" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" } ], "common_name": "Yeast" } ], "gene": [ { "name": "ICS2", "url": "https://www.uniprot.org/uniprot/P38284", "locus": {} } ], "crossref": [ { "id": "852454", "url": "https://www.ncbi.nlm.nih.gov/gene/852454", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P38284", "url": "https://www.ebi.ac.uk/intact/interactors/id:P38284*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "sce:YBR157C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBR157C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PKNTIMN", "url": "https://omabrowser.org/oma/group/PKNTIMN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2028910at2759", "url": "http://www.orthodb.org/?query=2028910at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_P38284", "url": "http://purl.obolibrary.org/obo/PR_P38284", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_009715", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009715", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000000361", "url": "https://www.yeastgenome.org/locus/S000000361", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P38284-1", "url": "https://www.uniprot.org/uniprot/P38284-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKFEQKERERISTFSFPTTGSQSSTSIKSLGSPLYGRFSSLSSTESQFDSSKQPHEYEKSFYFEESQGEALFNKLKTYSFPGDKDGVKTRRNSSICPRKPNAVSPLRVESNELSSHSHSRSLSHELTKPSGRRKSYHRKSHAISFSRSCKPNFIDGYDSNSSIGVNSRKTSLASSFLDKEYHSSPDTSYTHQMSPKNTIMNTNEQLRRNASGRFGSLKEFAEKNQINIEGKIFAHKVETGDILQPLIDLDIDNK", "length": 255, "header": "sp|P38284-1|ICS2_YEAST Isoform 1 of Increased copper sensitivity protein 2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=ICS2 PE=1 SV=2 CANONICAL=P38284-1" }, "isoforms": [ { "isoform_ac": "P38284-1", "url": "", "sequence": { "sequence": "MGKFEQKERERISTFSFPTTGSQSSTSIKSLGSPLYGRFSSLSSTESQFDSSKQPHEYEKSFYFEESQGEALFNKLKTYSFPGDKDGVKTRRNSSICPRKPNAVSPLRVESNELSSHSHSRSLSHELTKPSGRRKSYHRKSHAISFSRSCKPNFIDGYDSNSSIGVNSRKTSLASSFLDKEYHSSPDTSYTHQMSPKNTIMNTNEQLRRNASGRFGSLKEFAEKNQINIEGKIFAHKVETGDILQPLIDLDIDNK", "length": 255, "header": "sp|P38284-1|ICS2_YEAST Isoform 1 of Increased copper sensitivity protein 2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=ICS2 PE=1 SV=2 CANONICAL=P38284-1" }, "locus": { "chromosome": "II", "start_pos": 554310, "end_pos": 553546, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YBR157C_mRNA", "url": "https://www.ensembl.org/id/YBR157C_mRNA" }, { "database": "Ensembl Peptide", "id": "YBR157C", "url": "https://www.ensembl.org/id/YBR157C" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 105, "end_pos": 105, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser105" }, { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser122" }, { "start_pos": 124, "end_pos": 124, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser124" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser141" }, { "start_pos": 145, "end_pos": 145, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser145" }, { "start_pos": 147, "end_pos": 147, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser147" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" } ], "site_lbl": "Ser172" }, { "start_pos": 217, "end_pos": 217, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" }, { "database": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" }, { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" } ], "site_lbl": "Ser217" }, { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P38284", "url": "https://www.yeastgenome.org/locus/P38284" } ], "site_lbl": "Ser27" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P38284", "url": "https://www.yeastgenome.org/locus/P38284" } ], "site_lbl": "Ser30" }, { "start_pos": 33, "end_pos": 33, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P38284", "url": "https://www.yeastgenome.org/locus/P38284" } ], "site_lbl": "Ser33" }, { "start_pos": 36, "end_pos": 36, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P38284", "url": "https://www.yeastgenome.org/locus/P38284" } ], "site_lbl": "Tyr36" }, { "start_pos": 40, "end_pos": 40, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P38284", "url": "https://www.yeastgenome.org/locus/P38284" } ], "site_lbl": "Ser40" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P38284", "url": "https://www.yeastgenome.org/locus/P38284" } ], "site_lbl": "Ser43" }, { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P38284", "url": "https://www.yeastgenome.org/locus/P38284" } ], "site_lbl": "Ser44" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "P38284", "url": "https://www.yeastgenome.org/locus/P38284" } ], "site_lbl": "Thr45" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Thr90" }, { "start_pos": 94, "end_pos": 94, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser94" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Functional analysis of 150 deletion mutants in Saccharomyces cerevisiae by a systematic approach.", "journal": "Mol. Gen. Genet.", "date": "1999", "authors": "Hansen M., Rose M., Meyer P., Wolf K., Klein S., Feldmann H., Jansen G., Schaefer B., Kramer W., Goetz R., Koetter P., Entian K.-D., Munder T., Launhardt H., Hollenberg C.P., Kricke J., Becher D., Gueldener U., Hegemann J.H., Hinnen A., Mannhaupt G., Schuster T., Zimmermann F.K., Zollner A., Maierl A., Mewes W., Niedenthal R.K., Ramezani Rad M., Roehmer A., Roemer A., Siegler M.-L., Vetter J., Wilhelm N.", "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" } ], "reference": [ { "type": "PubMed", "id": "10628851", "url": "https://glygen.org/publication/PubMed/10628851" } ] }, { "title": "Sequencing and comparison of yeast species to identify genes and regulatory elements.", "journal": "Nature", "date": "2003", "authors": "Birren B.W., Lander E.S., Kellis M., Patterson N., Endrizzi M.", "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" } ], "reference": [ { "type": "PubMed", "id": "12748633", "url": "https://glygen.org/publication/PubMed/12748633" } ] }, { "title": "Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii.", "journal": "Genome Biol.", "date": "2003", "authors": "Zhang Z., Philippsen P., Stuart L., Dietrich F.S., Brachat S., Gaffney T.D., Gates K., Lerch A., Voegeli S.", "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" } ], "reference": [ { "type": "PubMed", "id": "12844361", "url": "https://glygen.org/publication/PubMed/12844361" } ] }, { "title": "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway.", "journal": "Molecular & cellular proteomics : MCP", "date": "2005-03", "authors": "Gruhler Albrecht, Olsen Jesper V, Mohammed Shabaz, Mortensen Peter, Faergeman Nils J, Mann Matthias, Jensen Ole N", "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" }, { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" } ], "reference": [ { "type": "PubMed", "id": "15665377", "url": "https://glygen.org/publication/PubMed/15665377" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science", "date": "2009", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" }, { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "P38284", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38284" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R", "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" } ], "reference": [ { "type": "PubMed", "id": "22814378", "url": "https://glygen.org/publication/PubMed/22814378" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Sequence and functional analysis of a 7.2 kb DNA fragment containing four open reading frames located between RPB5 and CDC28 on the right arm of chromosome II.", "journal": "Yeast", "date": "1995", "authors": "Rose M., Entian K.-D., Proft M., Kiesau P.", "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" } ], "reference": [ { "type": "PubMed", "id": "7483850", "url": "https://glygen.org/publication/PubMed/7483850" } ] }, { "title": "Complete DNA sequence of yeast chromosome II.", "journal": "EMBO J.", "date": "1994", "authors": "Gassenhuber J., Mewes H.-W., Obermaier B., Stucka R., Rose M., Wagner G., Boles E., Brueckner M., Jacquet M., Rieger M., Mueller S., Molemans F., Zagulski M., Brandt T., Christiansen C., Barthe C., Feldmann H., Kleine K., Cziepluch C., Fiers W., Mallet L., Jauniaux J.-C., Dubois E., Andre B., Li Z.Y., Koetter P., Hein C., Entian K.-D., Slonimski P.P., Vetter I., Nasr F., Louis E.J., Delaveau T., Hollenberg C.P., Contreras R., Domdey H., Pohl T.M., Brendel M., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Dujon B., El Bakkoury M., Feuermann M., Glansdorff N., Goffeau A., Grivell L.A., Herbert C.J., Jacq C., Mannhaupt G., Messenguy F., Miosga T., Perea J., Pierard A., Potier S., Proft M., Schaaff-Gerstenschlaeger I., Scherens B., Souciet J.-L., Steensma H.Y., Vissers S., Zimmermann F.K., Aljinovic G., Duesterhus S., Jonniaux J.-L., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Urrestarazu L.A., Vierendeels F., de Wergifosse P., Aigle M., Baclet M.C., Baur A., Biteau N., Demolis N., Fobo G.M., Fritz C., Holmstroem K., Kallesoee T., Kiesau P., Korol S., Liebl S., Logghe M., Lohan A.J.E., Maat M.J., Piravandi E., Pohl F.M., Schwarzlose C., Smits P.H.M., Van Dyck L., Vassarotti A., Wolfe K.H., de Haan M., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "P38284", "url": "https://www.uniprot.org/uniprot/P38284" } ], "reference": [ { "type": "PubMed", "id": "7813418", "url": "https://glygen.org/publication/PubMed/7813418" } ] } ], "pathway": [ { "id": "sce:YBR157C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBR157C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 161, "end_pos": 163, "annotation": "n_glycosylation_sequon" }, { "start_pos": 210, "end_pos": 212, "annotation": "n_glycosylation_sequon" }, { "start_pos": 93, "end_pos": 95, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 18 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }