{ "uniprot_canonical_ac": "P38212-1", "uniprot_ac": "P38212", "uniprot_id": "RCR1_YEAST", "mass": { "chemical_mass": 23887.0, "monoisotopic_mass": 23887.0 }, "refseq": { "ac": "NP_009559", "name": "Rcr1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009559" }, "gene_names": [ { "name": "RCR1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P38212", "id": "P38212" }, { "name": "RCR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009559", "id": "NP_009559" }, { "name": "SSH6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009559", "id": "NP_009559" }, { "name": "YBR0111", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P38212", "id": "P38212" } ], "protein_names": [ { "name": "Protein RCR1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P38212" }, { "name": "Rcr1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009559", "id": "NP_009559" }, { "name": "Resistance to Congo red protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P38212" } ], "function": [ { "annotation": "Regulates chitin deposition in the cell wall.", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212#function" }, { "database": "PubMed", "id": "15590673", "url": "https://glygen.org/publication/PubMed/15590673" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 105, "end_pos": 105, "sequence_org": "P", "sequence_mut": "A", "comment": "Reduced interaction with WW domain of RSP5. No interaction with WW domain of RSP5; when in association with 82-QA-83.", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" }, { "database": "PubMed", "id": "17213653", "url": "https://glygen.org/publication/PubMed/17213653" } ] }, { "start_pos": 130, "end_pos": 130, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect in conferring Congo red resistance; when associated with A-208.", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" }, { "database": "PubMed", "id": "17213653", "url": "https://glygen.org/publication/PubMed/17213653" } ] }, { "start_pos": 208, "end_pos": 208, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect in conferring Congo red resistance; when associated with A-130.", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" }, { "database": "PubMed", "id": "17213653", "url": "https://glygen.org/publication/PubMed/17213653" } ] }, { "start_pos": 82, "end_pos": 83, "sequence_org": "PP", "sequence_mut": "QA", "comment": "Reduced interaction with WW domain of RSP5. No interaction with WW domain of RSP5; when in association with A-105.", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" }, { "database": "PubMed", "id": "17213653", "url": "https://glygen.org/publication/PubMed/17213653" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "common_name": "Yeast" } ], "gene": [ { "name": "RCR1", "url": "https://www.uniprot.org/uniprot/P38212", "locus": { "chromosome": "II", "start_pos": 246547, "end_pos": 245906, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "YBR005W", "url": "https://www.ensembl.org/id/YBR005W" } ] } } ], "crossref": [ { "id": "852290", "url": "https://www.ncbi.nlm.nih.gov/gene/852290", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P38212", "url": "https://www.ebi.ac.uk/intact/interactors/id:P38212*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR020999", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020999", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YBR005W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBR005W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SLDTDYG", "url": "https://omabrowser.org/oma/group/SLDTDYG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2014620at2759", "url": "http://www.orthodb.org/?query=2014620at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28187", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28187", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28187:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28187:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF12273", "url": "http://pfam.xfam.org/family/PF12273", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P38212", "url": "http://purl.obolibrary.org/obo/PR_P38212", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_009559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009559", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000000209", "url": "https://www.yeastgenome.org/locus/S000000209", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P38212-1", "url": "https://www.uniprot.org/uniprot/P38212-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGLISYENEAINEVKKADNHHVSKFVTSYYGPSSSSWQSGIWILFVLFVAAVILIILFTFVANRRRRRMGRAPIRGTAWLTPPSYRQSQQQYTGTVQQRTDDYVPEYTETANEHDLGYYDQRGEFHPNDKAAYVAPPPLVQECSSESVNSLERPPAAVVHQANSLDTDYGLTRPSNGRVPAVSDTVEQLERLPGGTTTQEINPPERAKVNARS", "length": 213, "header": "sp|P38212-1|RCR1_YEAST Isoform 1 of Protein RCR1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=RCR1 PE=1 SV=1 CANONICAL=P38212-1" }, "isoforms": [ { "isoform_ac": "P38212-1", "url": "", "sequence": { "sequence": "MGLISYENEAINEVKKADNHHVSKFVTSYYGPSSSSWQSGIWILFVLFVAAVILIILFTFVANRRRRRMGRAPIRGTAWLTPPSYRQSQQQYTGTVQQRTDDYVPEYTETANEHDLGYYDQRGEFHPNDKAAYVAPPPLVQECSSESVNSLERPPAAVVHQANSLDTDYGLTRPSNGRVPAVSDTVEQLERLPGGTTTQEINPPERAKVNARS", "length": 213, "header": "sp|P38212-1|RCR1_YEAST Isoform 1 of Protein RCR1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=RCR1 PE=1 SV=1 CANONICAL=P38212-1" }, "locus": { "chromosome": "II", "start_pos": 246544, "end_pos": 245906, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YBR005W_mRNA", "url": "https://www.ensembl.org/id/YBR005W_mRNA" }, { "database": "Ensembl Peptide", "id": "YBR005W", "url": "https://www.ensembl.org/id/YBR005W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 164, "end_pos": 164, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38212", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38212" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P38212", "url": "https://www.yeastgenome.org/locus/P38212" } ], "site_lbl": "Ser164" }, { "start_pos": 93, "end_pos": 93, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P38212", "url": "https://www.yeastgenome.org/locus/P38212" }, { "database": "iPTMnet", "id": "P38212", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38212" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr93" } ], "glycation": [], "keywords": [], "publication": [ { "title": "A novel endoplasmic reticulum membrane protein Rcr1 regulates chitin deposition in the cell wall of Saccharomyces cerevisiae.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Adachi H., Imai K., Noda Y., Yoda K.", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "reference": [ { "type": "PubMed", "id": "15590673", "url": "https://glygen.org/publication/PubMed/15590673" } ] }, { "title": "Peculiar protein-protein interactions of the novel endoplasmic reticulum membrane protein Rcr1 and ubiquitin ligase Rsp5.", "journal": "Biosci. Biotechnol. Biochem.", "date": "2007", "authors": "Imai Keita, Noda Yoichi, Adachi Hiroyuki, Yoda Koji", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "reference": [ { "type": "PubMed", "id": "17213653", "url": "https://glygen.org/publication/PubMed/17213653" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P38212", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38212" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P38212", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38212" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Complete DNA sequence of yeast chromosome II.", "journal": "EMBO J.", "date": "1994", "authors": "Gassenhuber J., Mewes H.-W., Obermaier B., Stucka R., Rose M., Wagner G., Boles E., Brueckner M., Jacquet M., Rieger M., Mueller S., Molemans F., Zagulski M., Brandt T., Christiansen C., Barthe C., Feldmann H., Kleine K., Cziepluch C., Fiers W., Mallet L., Jauniaux J.-C., Dubois E., Andre B., Li Z.Y., Koetter P., Hein C., Entian K.-D., Slonimski P.P., Vetter I., Nasr F., Louis E.J., Delaveau T., Hollenberg C.P., Contreras R., Domdey H., Pohl T.M., Brendel M., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Dujon B., El Bakkoury M., Feuermann M., Glansdorff N., Goffeau A., Grivell L.A., Herbert C.J., Jacq C., Mannhaupt G., Messenguy F., Miosga T., Perea J., Pierard A., Potier S., Proft M., Schaaff-Gerstenschlaeger I., Scherens B., Souciet J.-L., Steensma H.Y., Vissers S., Zimmermann F.K., Aljinovic G., Duesterhus S., Jonniaux J.-L., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Urrestarazu L.A., Vierendeels F., de Wergifosse P., Aigle M., Baclet M.C., Baur A., Biteau N., Demolis N., Fobo G.M., Fritz C., Holmstroem K., Kallesoee T., Kiesau P., Korol S., Liebl S., Logghe M., Lohan A.J.E., Maat M.J., Piravandi E., Pohl F.M., Schwarzlose C., Smits P.H.M., Van Dyck L., Vassarotti A., Wolfe K.H., de Haan M., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "reference": [ { "type": "PubMed", "id": "7813418", "url": "https://glygen.org/publication/PubMed/7813418" } ] } ], "pathway": [ { "id": "sce:YBR005W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBR005W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "vesicle-mediated transport", "id": "GO:0016192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016192", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "pmid": "" }, { "name": "chitin localization", "id": "GO:0006033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006033", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "pmid": "" }, { "name": "cell wall organization", "id": "GO:0071555", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071555", "evidence": [ { "database": "UniProtKB", "id": "P38212", "url": "https://www.uniprot.org/uniprot/P38212" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }