{ "uniprot_canonical_ac": "P36412-1", "uniprot_ac": "P36412", "uniprot_id": "RB11A_DICDI", "mass": { "chemical_mass": 23986.0, "monoisotopic_mass": 23986.0 }, "refseq": { "ac": "XP_646557", "name": "Rab GTPase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646557" }, "gene_names": [ { "name": "rab11A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P36412", "id": "P36412" }, { "name": "DDB_G0269238", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P36412", "id": "P36412" }, { "name": "rab11A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646557", "id": "XP_646557" }, { "name": "rab11", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P36412", "id": "P36412" } ], "protein_names": [ { "name": "Ras-related protein Rab-11A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P36412" }, { "name": "Rab GTPase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646557", "id": "XP_646557" } ], "function": [ { "annotation": "Required for normal contractile vacuole structure and function. Cells expressing a dominant negative rab11A exhibit a more extensive contractile vacuole network and enlarged contractile vacuole bladders. These cells exhibit a functional defect in osmotic regulation where cells immersed in water become rounded and detach from the surface, and contain swollen contractile vacuoles.", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412#function" }, { "database": "PubMed", "id": "11686306", "url": "https://glygen.org/publication/PubMed/11686306" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 126, "end_pos": 126, "sequence_org": "N", "sequence_mut": "I", "comment": "Loss of GTP-binding activity.", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" }, { "database": "PubMed", "id": "11686306", "url": "https://glygen.org/publication/PubMed/11686306" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "common_name": "Dictyostelium discoideum" } ], "gene": [ { "name": "rab11A", "url": "https://www.uniprot.org/uniprot/P36412", "locus": {} } ], "crossref": [ { "id": "cd01868", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01868", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0269238", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "8617525", "url": "https://www.ncbi.nlm.nih.gov/gene/8617525", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P36412", "url": "https://www.ebi.ac.uk/intact/interactors/id:P36412*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0269238", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0269238", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SMKEDYY", "url": "https://omabrowser.org/oma/group/SMKEDYY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR47979", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47979", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47979:SF33", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47979:SF33", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00071", "url": "http://pfam.xfam.org/family/PF00071", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P36412", "url": "http://purl.obolibrary.org/obo/PR_P36412", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-8854214", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8854214", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8873719", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_646557", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646557", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P36412-1", "url": "https://www.uniprot.org/uniprot/P36412-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTSKGSQEEYDYLYKIVLIGDSGVGKSNLLSRFTRNEFSLETKSTIGVEFATRTIQTEGKTIKAQVWDTAGQERYRAITSAYYRGAVGALLVYDIAKQATYKSVERWILELRENADRNIEIMLVGNKSDLRHLREVSTDEAKEFSEKHKLTFIETSALDSSNVELAFQNILTQIYHIMSRPSHSTGPQTTIDSNTETIILPTTSEPPAAKSGCC", "length": 214, "header": "sp|P36412-1|RB11A_DICDI Isoform 1 of Ras-related protein Rab-11A OS=Dictyostelium discoideum OX=44689 GN=rab11A PE=1 SV=1 CANONICAL=P36412-1" }, "isoforms": [ { "isoform_ac": "P36412-1", "url": "", "sequence": { "sequence": "MTSKGSQEEYDYLYKIVLIGDSGVGKSNLLSRFTRNEFSLETKSTIGVEFATRTIQTEGKTIKAQVWDTAGQERYRAITSAYYRGAVGALLVYDIAKQATYKSVERWILELRENADRNIEIMLVGNKSDLRHLREVSTDEAKEFSEKHKLTFIETSALDSSNVELAFQNILTQIYHIMSRPSHSTGPQTTIDSNTETIILPTTSEPPAAKSGCC", "length": 214, "header": "sp|P36412-1|RB11A_DICDI Isoform 1 of Ras-related protein Rab-11A OS=Dictyostelium discoideum OX=44689 GN=rab11A PE=1 SV=1 CANONICAL=P36412-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Rab11-like GTPase associates with and regulates the structure and function of the contractile vacuole system in dictyostelium.", "journal": "J. Cell Sci.", "date": "2001", "authors": "Harris E, Yoshida K, Cardelli J, Bush J", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "reference": [ { "type": "PubMed", "id": "11686306", "url": "https://glygen.org/publication/PubMed/11686306" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Chen G., Gibbs R.A., Gloeckner G., Hernandez J., Johnson D., Knights A., Lehmann R., Loulseged H., Ma J., Muzny D.M., Oliver K., Platzer M., Rosenthal A., Saito T., Sodergren E., Steffen D., Sugano S., Walker D., Weinstock G., Lu M., Muzny D., Tanaka Y., Song J., Sodergren E.J., Xu Q., Bankier A.T., Barrell B.G., Williams J., Fey P., Nie X., Gibbs R., Dear P.H., Szafranski K., Davies R., Price C., James K., Noegel A.A., Glockner G., Cooper J., Morio T., Davis P., Williams J.G., Kay R.R., Cronin A., Schleicher M., Olsen R., Kummerfeld S., Sharp S., Hauser H., Weinstock G.M., White B., Quiles M., Rost R., Tunggal B., Pain A., Madan Babu M., Madera M., Rivero F., Saunders D., Eichinger L., Sanders M., Kohara Y., Chisholm R.L., Barrell B., Churcher C.M., Hamlin N., Rajandream M.A., Thangavelu M., Quail M.A., Anjard C., Cox E.C., Haydock S., Kuspa A., Loomis W.F., Shaulsky G., Sucgang R., Urushihara H., Bason N., Berriman M., Buchrieser C., Churcher C., Desany B., Farbrother P., Felder M., Gaudet P., Goodhead I., Hall N., Harper D., Hemphill L., James K.D., Just E., Kerhornou A., Konfortov B.A., Lindsay R., Mourier T., Mungall K., Mungall K.L., Pachebat J.A., Pilcher K., Rabbinowitsch E., Simmonds M., Simmonds M.N., Spiegler S., Tivey A., Wardroper A., Winckler T., Woodward J., Woodward J.R., van Driessche N.", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Proteomics fingerprinting of phagosome maturation and evidence for the role of a Galpha during uptake.", "journal": "Mol. Cell. Proteomics", "date": "2006", "authors": "Ruppert T., Delorenzi M., Gotthardt D., Soldati T., Blancheteau V., Bosserhoff A.", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "reference": [ { "type": "PubMed", "id": "16926386", "url": "https://glygen.org/publication/PubMed/16926386" } ] } ], "pathway": [ { "id": "ddi:DDB_G0269238", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0269238", "resource": "KEGG Pathway" }, { "id": "R-DDI-8854214", "name": "TBC/RABGAPs", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8854214", "resource": "Reactome", "description": "TBC/RABGAPs" }, { "id": "R-DDI-8873719", "name": "RAB geranylgeranylation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8873719", "resource": "Reactome", "description": "RAB geranylgeranylation" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "cellular hypotonic response", "id": "GO:0071476", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071476", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "osmosensory signaling pathway", "id": "GO:0007231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007231", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "small GTPase mediated signal transduction", "id": "GO:0007264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007264", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "exocytosis", "id": "GO:0006887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006887", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "Rab protein signal transduction", "id": "GO:0032482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032482", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "protein localization to vacuolar membrane", "id": "GO:1903778", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903778", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "contractile vacuole organization", "id": "GO:0033298", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033298", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "nucleotide binding", "id": "GO:0000166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000166", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "GTPase activating protein binding", "id": "GO:0032794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032794", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "lipid droplet", "id": "GO:0005811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005811", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "recycling endosome", "id": "GO:0055037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "contractile vacuole", "id": "GO:0000331", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000331", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "contractile vacuolar membrane", "id": "GO:0031164", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031164", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" }, { "name": "pathogen-containing vacuole", "id": "GO:0140220", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140220", "evidence": [ { "database": "UniProtKB", "id": "P36412", "url": "https://www.uniprot.org/uniprot/P36412" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 126, "end_pos": 128, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }