{ "uniprot_canonical_ac": "P36136-1", "uniprot_ac": "P36136", "uniprot_id": "SHB17_YEAST", "mass": { "chemical_mass": 31022.0, "monoisotopic_mass": 31022.0 }, "refseq": { "ac": "NP_012969", "name": "sedoheptulose-bisphosphatase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012969" }, "gene_names": [ { "name": "SHB17", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P36136", "id": "P36136" }, { "name": "SHB17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012969", "id": "NP_012969" } ], "protein_names": [ { "name": "Sedoheptulose 1,7-bisphosphatase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P36136" }, { "name": "3.1.3.37", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P36136" }, { "name": "sedoheptulose-bisphosphatase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012969", "id": "NP_012969" } ], "function": [ { "annotation": "Sedoheptulose 1,7-bisphosphatase involved in riboneogenesis. Dephosphorylates sedoheptulose 1,7-bisphosphate (SBP), which is converted via the non-oxidative pentose phosphate pathway to ribose-5-phosphate. Has a fructose 1,6-bisphosphatase activity in vitro, but this is probably not biologically relevant, since deletion does not affect fructose 1,6-biphosphate (FBP) levels.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136#function" }, { "database": "PubMed", "id": "21663798", "url": "https://glygen.org/publication/PubMed/21663798" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 102, "end_pos": 102, "sequence_org": "Y", "sequence_mut": "A", "comment": "Impairs catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 12, "end_pos": 12, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 131, "end_pos": 131, "sequence_org": "W", "sequence_mut": "A", "comment": "Leads to reduced substrate affinity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 13, "end_pos": 13, "sequence_org": "H", "sequence_mut": "A", "comment": "Impairs catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 16, "end_pos": 16, "sequence_org": "T", "sequence_mut": "A", "comment": "Impairs catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 176, "end_pos": 176, "sequence_org": "H", "sequence_mut": "A", "comment": "Impairs catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 178, "end_pos": 178, "sequence_org": "H", "sequence_mut": "A", "comment": "Leads to low activity and reduced substrate affinity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 181, "end_pos": 181, "sequence_org": "R", "sequence_mut": "A", "comment": "Leads to reduced substrate affinity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 19, "end_pos": 19, "sequence_org": "S", "sequence_mut": "A", "comment": "Leads to reduced substrate affinity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 24, "end_pos": 24, "sequence_org": "Y", "sequence_mut": "A", "comment": "Leads to low activity and reduced substrate affinity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 65, "end_pos": 65, "sequence_org": "S", "sequence_mut": "A", "comment": "Leads to low activity and reduced substrate affinity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 69, "end_pos": 69, "sequence_org": "R", "sequence_mut": "A", "comment": "Leads to reduced substrate affinity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "start_pos": 99, "end_pos": 99, "sequence_org": "E", "sequence_mut": "A", "comment": "Impairs catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" }, { "database": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "common_name": "Yeast" } ], "gene": [ { "name": "SHB17", "url": "https://www.uniprot.org/uniprot/P36136", "locus": {} } ], "crossref": [ { "id": "3.1.3.11", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.3.11&UniProtAcc=P36136", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd07067", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07067", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "853917", "url": "https://www.ncbi.nlm.nih.gov/gene/853917", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P36136", "url": "https://www.ebi.ac.uk/intact/interactors/id:P36136*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013078", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013078", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029033", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029033", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YKR043C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YKR043C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GWLIWRD", "url": "https://omabrowser.org/oma/group/GWLIWRD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "156438at2759", "url": "http://www.orthodb.org/?query=156438at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48100", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48100", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48100:SF15", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48100:SF15", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3F3K", "url": "https://www.rcsb.org/structure/3F3K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LG2", "url": "https://www.rcsb.org/structure/3LG2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LL4", "url": "https://www.rcsb.org/structure/3LL4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3OI7", "url": "https://www.rcsb.org/structure/3OI7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00300", "url": "http://pfam.xfam.org/family/PF00300", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P36136", "url": "http://purl.obolibrary.org/obo/PR_P36136", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_012969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_012969", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000001751", "url": "https://www.yeastgenome.org/locus/S000001751", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P36136-1", "url": "https://www.uniprot.org/uniprot/P36136-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPSLTPRCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESVFRNNQFLNPDNITYIFTSPRLRARQTVDLVLKPLSDEQRAKIRVVVDDDLREWEYGDYEGMLTREIIELRKSRGLDKERPWNIWRDGCENGETTQQIGLRLSRAIARIQNLHRKHQSEGRASDIMVFAHGHALRYFAAIWFGLGVQKKCETIEEIQNVKSYDDDTVPYVKLESYRHLVDNPCFLLDAGGIGVLSYAHHNIDEPALELAGPFVSPPEEESQHGDV", "length": 271, "header": "sp|P36136-1|SHB17_YEAST Isoform 1 of Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae S288C OX=559292 GN=SHB17 PE=1 SV=1 CANONICAL=P36136-1" }, "isoforms": [ { "isoform_ac": "P36136-1", "url": "", "sequence": { "sequence": "MPSLTPRCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESVFRNNQFLNPDNITYIFTSPRLRARQTVDLVLKPLSDEQRAKIRVVVDDDLREWEYGDYEGMLTREIIELRKSRGLDKERPWNIWRDGCENGETTQQIGLRLSRAIARIQNLHRKHQSEGRASDIMVFAHGHALRYFAAIWFGLGVQKKCETIEEIQNVKSYDDDTVPYVKLESYRHLVDNPCFLLDAGGIGVLSYAHHNIDEPALELAGPFVSPPEEESQHGDV", "length": 271, "header": "sp|P36136-1|SHB17_YEAST Isoform 1 of Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae S288C OX=559292 GN=SHB17 PE=1 SV=1 CANONICAL=P36136-1" }, "locus": { "chromosome": "XI", "start_pos": 521712, "end_pos": 520900, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YKR043C_mRNA", "url": "https://www.ensembl.org/id/YKR043C_mRNA" }, { "database": "Ensembl Peptide", "id": "YKR043C", "url": "https://www.ensembl.org/id/YKR043C" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P36136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36136" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Ser3" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Structure and activity of the metal-independent fructose-1,6-bisphosphatase YK23 from Saccharomyces cerevisiae.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Kuznetsova Ekaterina, Xu Linda, Singer Alexander, Brown Greg, Dong Aiping, Flick Robert, Cui Hong, Cuff Marianne, Joachimiak Andrzej, Savchenko Alexei, Yakunin Alexander F", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "reference": [ { "type": "PubMed", "id": "20427268", "url": "https://glygen.org/publication/PubMed/20427268" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P36136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36136" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Riboneogenesis in yeast.", "journal": "Cell", "date": "2011", "authors": "Xu X., Singer A., Rabinowitz J.D., Cui H., Dong A., Caudy A.A., Savchenko A., Yakunin A.F., Campagna S.R., Clasquin M.F., Gooding J.R., Melamud E.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "reference": [ { "type": "PubMed", "id": "21663798", "url": "https://glygen.org/publication/PubMed/21663798" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Complete DNA sequence of yeast chromosome XI.", "journal": "Nature", "date": "1994", "authors": "Ansorge W., Duesterhoeft A., Mewes H.-W., Obermaier B., Wiemann S., Legrain P., Zimmermann J., Xu G., Rose M., Planta R.J., Colleaux L., Rieger M., Fukuhara H., Portetelle D., Mueller S., Becker I., Feldmann H., Kleine K., Gonzalez A., Hewitt N., Schwager C., Voss H., Jimenez A., Erfle H., Jauniaux J.-C., Jacquier A., Dion C., Maia e Silva A., Pallier C., Stegemann J., Andre B., Cheret G., Sor F., Haasemann M., Koetter P., Entian K.-D., Baladron V., Vilela C., Thierry A., Louis E.J., Hollenberg C.P., Marck C., Santos M.A., Soares H., Philippsen P., Poehlmann R., Vandenbol M., Domdey H., Garcia-Ramirez J.J., Pohl T.M., James C.M., Pfeiffer F., Ghazvini M., Ballesta J.P.G., Bossier P., Daignan-Fornier B., Dujon B., Esteban P.F., Fernandes L., Goffeau A., Hegemann J.H., Hilger F., Oliver S.G., Remacha M.A., Revuelta J.L., Rodrigues-Pousada C., Vissers S., del Rey F., van Dyck L., Alexandraki D., Bolotin-Fukuhara M., Duesterhus S., Guerreiro P., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Tzermia M., Urrestarazu L.A., Banrevi A., Bolle P.-A., Bou G., Boyer J., Buitrago M.J., Fobo G.M., Fritz C., Gabel C., Gaillon L., Garcia-Cantalejo J.M., Gent M.E., Grothues D., Horaitis O., Indge K.J., Keuchel H., Liebl S., Moestl D., Monnier A.-L., Pascolo S., Pohl F.M., Puzos V., Rasmussen S.W., Richard G.-F., Rupp T., Sensen C., Tettelin H., Valens M., van Vliet-Reedijk J.C., von Wettstein D.", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "reference": [ { "type": "PubMed", "id": "8196765", "url": "https://glygen.org/publication/PubMed/8196765" } ] } ], "pathway": [ { "id": "sce:YKR043C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YKR043C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "carbohydrate metabolic process", "id": "GO:0005975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005975", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "pmid": "" }, { "name": "ribose phosphate biosynthetic process", "id": "GO:0046390", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046390", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "oxidoreductase activity", "id": "GO:0016491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016491", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "pmid": "" }, { "name": "sedoheptulose-bisphosphatase activity", "id": "GO:0050278", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050278", "evidence": [ { "database": "UniProtKB", "id": "P36136", "url": "https://www.uniprot.org/uniprot/P36136" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17461", "name": "", "equation": "D-sedoheptulose 1,7-bisphosphate + H2O = D-sedoheptulose 7-phosphate + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P36136-1" ], "evidence": [ { "id": "17461", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17461" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P36136", "gene_name": "SHB17", "activity": [ { "ec_number": "3.1.3.37", "activity": "D-sedoheptulose 1,7-bisphosphate + H2O = D-sedoheptulose 7-phosphate + phosphate.", "evidence": [ { "id": "P36136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36136" } ] }, { "ec_number": "3.1.3.37", "activity": "", "evidence": [ { "id": "P36136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36136" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }